KEGG   Calditerrivibrio nitroreducens: Calni_0980Help
Entry
Calni_0980        CDS       T01364                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calni_0980
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calni_0980
Enzymes [BR:cni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Calni_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1023559..1024320
Genome map
AA seq 253 aa AA seqDB search
MNNKLLEIVNYKKEYVKRLPRIELKRNKAILDPRKFLLNNPIIAEFKKASPSAGIINDGI
SLEERVLEYQRSGAGMVSVLTDEKFFGGSFEYLSKASQILSIPTLCKDFIISEIQIDYAY
SCGADAVLLIAAILDDKLLHQLVYYAKKLSLNILLEIHTELEYERVKDLSVEMIGVNSRN
LDTFQIDKNNAAMIISKVKHDFVVAESGIEDENDLKMFKIAGAKGFLIGTSLMRSKNLAD
TFTKLYRGLKDVC
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaactattggagatagtaaactacaaaaaagagtatgtaaaaagattacca
agaatagaattaaaaagaaacaaagctattctggatccgagaaagtttcttttaaataat
ccgattatagctgaatttaaaaaggcttcaccatctgctggcattataaatgacgggatt
agtctggaagagcgtgtgctggagtatcagcgttctggtgcaggtatggtaagtgtttta
actgatgaaaaattttttggaggttcgtttgaatatctatcaaaagcatctcagatcctt
tcgataccgactctttgtaaagattttatcatatccgagattcaaatagattatgcatat
agttgtggagcagatgctgttttgcttatagcagcgatattggatgataaactgttgcat
caacttgtttattacgcaaaaaaactttctcttaatatacttctggagattcatacggaa
ttggagtatgaaagggtgaaagatttaagtgttgagatgattggtgtaaactcaaggaat
cttgatacatttcagatagacaaaaataatgctgctatgattatcagtaaggttaaacac
gattttgtggtggcggaaagtggaatagaggatgaaaacgatttaaaaatgtttaaaata
gctggggcaaagggatttttgataggcacctctttgatgaggtctaaaaatttagctgat
actttcacgaaactttatagaggcttgaaagatgtttgttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system