KEGG   Calditerrivibrio nitroreducens: Calni_0983Help
Entry
Calni_0983        CDS       T01364                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calni_0983
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calni_0983
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calni_0983
Enzymes [BR:cni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calni_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1026021..1026719
Genome map
AA seq 232 aa AA seqDB search
MKGAYILADYPDRDLFIREFEYLCRSKVDFIEIGLPFNDPVADGPIIAKASNEVAERGYD
IDDIVDVIKLNNSKKIYIMTYANIIYNYGFERFSKRFESILDGVIVADLPNIGHEFFIKK
GFSLPLIPFATPESREKDLKKLNDFNGDFVYFIGIRGITGGEVDFKSENIKMKYSEIKSF
TDKKVIIGFGVKGVDDVSTILSYADGFVIGTEIVKRQDDFDEFKRYVDKIYL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgcatatattttggcagattacccagatagggatctttttattagagagttt
gaatatctatgtagatctaaagtagattttatcgaaataggtttaccgtttaacgatccg
gtggcagatggaccaattatagcaaaagcctccaatgaagtggctgaaagaggttatgat
atagatgatatagtagatgtaattaaattaaacaacagtaaaaaaatttatataatgacg
tatgcaaatatcatttataattatggctttgagaggttttccaaaagatttgaatctatt
ttagatggggttattgtggcggatttacccaacattggtcatgaattttttataaaaaag
ggattttctctgcctcttatcccttttgcaacgccggaatccagggaaaaagatttaaaa
aaactaaacgattttaatggggattttgtttatttcatagggattagagggattactgga
ggggaagtggatttcaaaagtgaaaatataaagatgaaatatagtgagataaaaagtttt
acagataaaaaagttattataggttttggtgtgaagggtgtagatgatgtctctacaatt
ttatcttacgctgatggcttcgtaataggcactgaaatagtaaaaagacaggatgatttt
gacgaatttaaaaggtatgtggataaaatatatttataa

DBGET integrated database retrieval system