KEGG   Calditerrivibrio nitroreducens: Calni_1162Help
Entry
Calni_1162        CDS       T01364                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00521  Streptomycin biosynthesis
cni00523  Polyketide sugar unit biosynthesis
cni01130  Biosynthesis of antibiotics
Module
cni_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Calni_1162
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calni_1162
Enzymes [BR:cni01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Calni_1162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADR19071
JGI: Calni_1162
UniProt: E4TIM3
Position
complement(1222547..1223110)
Genome map
AA seq 187 aa AA seqDB search
MGKRLTIQQTYIEGLKIVETASYIDTRGAFTRLYCECELAEIIGSRRIVQINHSCTQQVG
TVRGLHFQYPPHAEMKLVRCLRGRVWDVAVDLRANSPTFLHWHAEELTPENGRMIIIPEG
FAHGFQVLEAASELLYLHTAYYAPSAEAGFRYDDPCLGIKWPLPVSELSPRDANHPLLKP
DFSGIAL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagagattgaccattcaacaaacctatattgaaggtcttaagattgtcgaaaca
gcttcttatattgatacccgtggtgcattcacccgactctattgcgaatgcgaactcgct
gagatcataggtagccggcgcatcgtccagatcaaccactcttgtactcagcaagtaggt
accgtgcgtggtttgcacttccagtacccgcctcatgccgagatgaagctggtgcgctgt
ctcagagggcgagtgtgggatgttgccgttgatctgagggccaactcccctacctttctt
cactggcacgccgaggagctgacgcccgaaaacggtcgtatgataatcattcctgaaggt
tttgcccacggttttcaggtgttggaggcagcaagcgaactgctctatctgcacactgct
tactatgcaccatctgcagaagcgggttttcgctacgacgatccgtgccttggcatcaaa
tggccacttcccgtctccgaactctcgccccgtgatgccaaccatccgttgcttaagcca
gacttttcagggattgctttatga

DBGET integrated database retrieval system