KEGG   Calditerrivibrio nitroreducens: Calni_1189Help
Entry
Calni_1189        CDS       T01364                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cni  Calditerrivibrio nitroreducens
Brite
Enzymes [BR:cni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Calni_1189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1250243..1251178)
Genome map
AA seq 311 aa AA seqDB search
MANKKVILRWFILPWVLFAIIFGMVLLMNKKPPYRLDRYPDLKNVDIAELVSIDKKRALS
EGVSNSRNMPEFKKGERNVGILLIHGFTASPFEMSELGEYLNSKGFTIYNSRVVGHGSKS
VYLDKLTYRDWYDSLKYGYFTLKNSCKKLFVIGQSMGGLLALNVAYYNDLDGVVLLSPAL
DILDSRFDFVPIAQYFVNSIEKEYSDTSNLKEYYYGERSVKGMVHLKYLIEYTWEHKDLL
KKPILLFHSKFDDVVNYRGSVKFYNEVSVPKELVLIDDPKVKHILSSSLNPRKEEIYKKI
LDWLEANDVEK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaataaaaaggttatcctgagatggtttatattaccgtgggtactatttgcaatt
atttttggaatggtgttgcttatgaataaaaagccaccttaccgattggatagatatcct
gatttgaaaaatgttgatatagctgagctggtatcgattgataagaaaagggctttatct
gaaggggtatcgaatagcagaaatatgcccgaatttaagaagggtgaacgcaacgttggg
attctattaatccatggtttcaccgcctccccttttgagatgtcggagcttggggagtat
ctaaatagcaaaggttttaccatttacaattcaagggtagtggggcatggttcaaaatcg
gtttatctcgataagttaacctacagagattggtatgattctttaaaatatggatatttt
actctgaaaaatagctgtaaaaagctttttgtaatagggcagtcgatgggtggattactg
gcactaaacgtggcgtattacaatgatctggatggtgttgttcttctatccccagccctt
gatattctggattcaagattcgactttgttccaatagcacagtattttgtaaatagtata
gaaaaggaatattccgacacatccaacctcaaagagtattactatggggagaggtctgtt
aaggggatggtacacctgaagtatctcatagagtatacatgggaacataaggatctacta
aaaaaaccgatacttctttttcattctaagtttgatgacgtggtgaattaccgtggcagt
gtaaaattttataatgaagtttcagttccaaaagagcttgttttaattgacgatccaaaa
gtaaaacatattttatcgagtagtttaaaccccaggaaggaagagatatataaaaagata
ttagattggttggaggctaatgatgttgaaaaataa

DBGET integrated database retrieval system