KEGG   Calditerrivibrio nitroreducens: Calni_1232Help
Entry
Calni_1232        CDS       T01364                                 

Definition
holliday junction DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calni_1232
Enzymes [BR:cni01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Calni_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1288840..1289418)
Genome map
AA seq 192 aa AA seqDB search
MIAKLRGKLHEKKPNYIILDVNGIFFEISISLNCFTSLPDLNSELIISTYTIVREDGISI
YGFLNDDEKRLFLLLNSVSKVGPKLALSILSTCEIVKLKSAIKNRDINLIATAPGVGKKT
AERIILELRDKIEEFEVVMDADTGGLDDDIISALVNLGYKKVDALSALKRLDDRYKTFEE
RLREALKLLNKL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgattgcaaaactaagaggtaaactccacgaaaaaaaacctaattatatcattcttgat
gtaaatgggatcttttttgagatatcgatttcattaaactgctttacatcactccctgat
ttgaattctgagctaattatctccacctatactattgtgagggaggatgggataagtatt
tacggatttttaaacgatgatgagaaacgtttgtttcttttgctaaactctgtttcaaaa
gttggacccaaacttgccctctccatcctttccacctgtgagatagtaaaattaaagtct
gcaataaaaaacagagatataaatctaatagcaacagcacccggagtgggaaaaaaaacc
gccgaaaggatcattctggaactgagggataagatagaagagtttgaagttgtcatggat
gcagatactggtggcttagatgatgatattataagtgcgcttgtgaatcttggttacaaa
aaggtggacgcactatcagcgttaaaaagattggatgacagatataaaacctttgaagaa
aggctcagggaagctttgaaattgctgaataaactttag

DBGET integrated database retrieval system