KEGG   Calditerrivibrio nitroreducens: Calni_1238Help
Entry
Calni_1238        CDS       T01364                                 

Definition
(RefSeq) l-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calni_1238
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calni_1238
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Calni_1238
Enzymes [BR:cni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Calni_1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1292125..1293519
Genome map
AA seq 464 aa AA seqDB search
MKYKSTRGKVNQLSFSETVLMGLADDGGLIIPEKIPQIGKEDILRLRDLPYKELALNIMG
YFIDDIPQSDLKKIIDDSYSTFDTEEVIPVVSFGGNLFIGEIFHGPTHAFKDIALQFLGN
LFSFILNQKGQKMNILGATSGDTGSAAIYGFKGKKDINIFILHPHGKVSPVQELQMTTVD
DKNVFNIAIEGTFDDCQFIVKSIFNDLEFKKRYSLGAINSINWSRVLAQIVYYFYTYFKS
TKDNNELPEVYFAVPTGNFGNIFAGFVARKMGLPIKKLILATNENNILTRFINNGDYSLS
KVVETYSPSMDIQIASNLERYLYFLYNEDSGILSEKMKEFEKNRSLSFQGNELKKIQSDF
ISVSTSNDQTLKMIKDFYEKYSYILDPHTACAINAVENVYNSDDIFIALATAHPAKFEDA
IVKAIGIKPEEPSRIKQIKGKPKKFTILKNSIEDVKRFIQETLS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacaaaagtacaagaggtaaagtaaatcagttatcctttagcgaaacagtcctc
atgggacttgcagatgatggtggtttgataataccggaaaagataccacaaattggaaaa
gaagatatattaaggttaagagatctcccctataaagagcttgcattaaatattatggga
tattttatcgacgatatcccccagagtgatctaaaaaaaattatcgatgatagctattcc
acttttgataccgaagaggttatacctgtggtctctttcggaggtaatctttttataggt
gagatcttccacggacctacccacgcatttaaagatatcgctttacaatttttgggcaac
cttttctcttttatactaaatcaaaaagggcagaaaatgaatatccttggggccacaagt
ggtgataccggaagtgctgccatatacggctttaaagggaaaaaagatatcaatatattt
atattacacccccatggaaaggtaagcccggtccaggagcttcagatgactacggtggac
gacaaaaatgtcttcaacatagccatcgaagggacatttgacgattgccagtttatcgta
aaatcgatattcaatgaccttgaatttaaaaaaagatattctttgggggcgataaactct
ataaactggtcaagggtactggcacagatcgtatactatttctacacatattttaaatcc
acaaaagacaacaatgagttgcccgaagtttattttgcagtacctacgggaaattttgga
aatatatttgccggtttcgtagccagaaaaatggggctaccgattaaaaaactgattttg
gccacaaatgaaaataatattttgacgaggtttatcaataatggggattatagcctatca
aaggtagttgaaacctatagcccctcaatggatatccagatcgccagtaaccttgaacga
tatctctattttctttacaacgaagactctgggatactttctgaaaaaatgaaagaattt
gaaaaaaacagatctctttcattccagggtaatgaactcaaaaaaatccagtctgacttc
atatctgtatccacaagcaatgatcaaacactaaaaatgataaaagatttttacgaaaaa
tattcatatattttagatccccataccgcatgtgcgatcaacgcagtggaaaatgtttac
aatagcgatgacatattcatagctcttgccacagctcatcctgctaaatttgaagatgca
atagtaaaagctatagggataaaacctgaagaaccctcaaggataaagcagatcaaaggt
aaaccaaaaaaatttacaatactaaaaaactcaatagaagatgtaaaaagattcatacag
gaaaccttaagttag

DBGET integrated database retrieval system