KEGG   Calditerrivibrio nitroreducens: Calni_1277Help
Entry
Calni_1277        CDS       T01364                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00340  Histidine metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
cni01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Calni_1277
Enzymes [BR:cni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Calni_1277
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADR19185
JGI: Calni_1277
UniProt: E4TJB8
Position
1332958..1334217
Genome map
AA seq 419 aa AA seqDB search
MIYKDTNEILPKILKRSDDYEEKYLSTVLSIIDDVKKNGDSALKIYSKKFDNNPDENLEV
TKKEMISAYDNIDEQLKLDLQLAKKNIEEYHKNQLEKSWFIEKEGTILGQKITPLDKVGV
YVPGGKASYPSTVLMNVIPAKVAGVKEVIVVTPAKDGKISEIVLAACYIAGVDKIFKIGG
AQAIAALSYGTETIPKVDKIVGPGNIYVALAKKLVFGRVDIDMIAGPSEILIIADDSANP
EYVAADMLSQAEHDELASSITITDSPNLAKEIEKYLNIHLKSLPKKDIAEKSLKQYGGVI
VVKNINEAVELSNSIAPEHLELAVKNPFELLPKIKHAGAIFLGHYTPEAMGDYFAGPNHT
LPTGGTARFSSPLGTYDFFKRSSIISYTRDSFLKQRENVYRLAKSEDLDAHALSVKVRG
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatttacaaagataccaatgagatattaccaaaaatactaaaaagaagcgatgattac
gaggaaaaatacctcagcactgtgctttcaattattgacgacgtaaagaaaaatggtgac
tctgctctaaaaatatattcaaaaaaatttgataataaccctgatgaaaatctcgaagtc
accaaaaaagagatgatttctgcttatgataatattgatgaacaattaaagctggatctt
caactggctaaaaaaaatatagaagaataccacaaaaatcagcttgaaaaatcctggttt
atcgaaaaggaaggtacaattttagggcagaagatcactccacttgataaagttggtgtt
tatgtacctggaggaaaggcaagctatccttccaccgtacttatgaatgtaatacctgcc
aaagtggcaggagtgaaagaggtaattgtcgtaacacctgcaaaagatggaaaaataagc
gaaatagtgcttgcggcctgttatatagctggagtggataaaatttttaaaatcgggggt
gcacaggctatagctgccctttcttatggcacagaaacgattcctaaagttgataagatc
gtaggacctgggaatatatacgttgcattagccaaaaaattggtattcggtagagtagac
atagatatgatagcaggtcccagtgaaatactcatcatcgccgatgattccgcaaaccca
gaatatgtggcagcagacatgctatcacaggcggagcatgacgaattggcatcttcaatt
accatcacagacagcccaaaccttgcaaaagaaatagaaaagtatttaaatattcacctt
aaatctcttcccaaaaaagatatcgctgagaagtctctaaaacagtatggaggggtaatt
gttgttaaaaatatcaatgaagctgtggaattatccaatagtattgcaccagagcatttg
gaattagcagtaaaaaacccttttgaacttcttccaaaaataaaacatgccggagcaatc
tttctggggcattatacacctgaagcaatgggtgattattttgcaggaccaaaccatacc
ctccccactggtggaacggccagattctcatcccctcttggaacgtatgacttcttcaag
agatcaagtataatatcatacacaagggatagctttttaaaacaaagggagaatgtttat
agactcgcaaaatcagaagatctcgatgcccatgcactctcggtaaaggtaaggggatag

DBGET integrated database retrieval system