KEGG   Calditerrivibrio nitroreducens: Calni_1303Help
Entry
Calni_1303        CDS       T01364                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00010  Glycolysis / Gluconeogenesis
cni00051  Fructose and mannose metabolism
cni00562  Inositol phosphate metabolism
cni01100  Metabolic pathways
cni01110  Biosynthesis of secondary metabolites
cni01120  Microbial metabolism in diverse environments
cni01130  Biosynthesis of antibiotics
cni01200  Carbon metabolism
cni01230  Biosynthesis of amino acids
Module
cni_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cni_M00002  Glycolysis, core module involving three-carbon compounds
cni_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calni_1303
   00051 Fructose and mannose metabolism
    Calni_1303
   00562 Inositol phosphate metabolism
    Calni_1303
Enzymes [BR:cni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Calni_1303
Exosome [BR:cni04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Calni_1303
  Exosomal proteins of bladder cancer cells
   Calni_1303
  Exosomal proteins of melanoma cells
   Calni_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADR19211
JGI: Calni_1303
UniProt: E4TJE4
Position
complement(1361699..1362454)
Genome map
AA seq 251 aa AA seqDB search
MRRSLIAANWKMNLTFDDALSFVSSFKEFKFDTKKIDVLIAPPFPYLSDLGKALKKINKK
IILSAQNIHFESSGAYTGEVSAEMLKSIGINWTIIGHSERRQYFGDTDIIVNKKVKKALE
NGLNVILCVGEQLPEREAGIEKELVISQLGMALYGVESDNISRIVIAYEPVWAIGTGKTA
RSSDAEEMHRSIREYIRSKYGRKIANNVRIIYGGSVKPDNISDLMSMPNIDGALVGGASL
KFESFAKIISY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatctttgattgcagcgaattggaagatgaatctaacttttgatgacgctctt
tcatttgtaagttcttttaaggaatttaaatttgatacaaaaaagatagatgttttgatc
gcaccaccatttccatatctatcggatcttgggaaggctctaaaaaaaataaataaaaag
attattttgtcagcccaaaatatccatttcgaatcatctggagcttatactggtgaagta
tctgcggagatgttgaaatctattggtatcaattggactattatcggacattcggagagg
agacagtactttggggataccgacattattgtaaacaaaaaggttaaaaaggctctcgag
aatggattaaatgttattctttgtgttggggagcaactcccagagagggaggctggcatt
gaaaaagagcttgtgataagtcagcttgggatggcactttatggtgtggaaagtgataat
atctccagaatagttatagcttatgagcctgtttgggctatagggacgggcaagacagcc
agatcttcagatgccgaagagatgcacaggtccattagggaatatataagaagtaagtat
ggaagaaaaattgccaataatgtaagaattatttatggtggaagtgtaaagcctgacaat
atctcagatcttatgagtatgccaaacattgatggtgcactggtgggtggggcaagtcta
aaatttgaaagttttgctaaaattataagttattga

DBGET integrated database retrieval system