KEGG   Calditerrivibrio nitroreducens: Calni_1303Help
Entry
Calni_1303        CDS       T01364                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Calni_1303
   01230 Biosynthesis of amino acids
    Calni_1303
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calni_1303
   00051 Fructose and mannose metabolism
    Calni_1303
   00562 Inositol phosphate metabolism
    Calni_1303
Enzymes [BR:cni01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Calni_1303
Exosome [BR:cni04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Calni_1303
  Exosomal proteins of bladder cancer cells
   Calni_1303
  Exosomal proteins of melanoma cells
   Calni_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1361699..1362454)
Genome map
AA seq 251 aa AA seqDB search
MRRSLIAANWKMNLTFDDALSFVSSFKEFKFDTKKIDVLIAPPFPYLSDLGKALKKINKK
IILSAQNIHFESSGAYTGEVSAEMLKSIGINWTIIGHSERRQYFGDTDIIVNKKVKKALE
NGLNVILCVGEQLPEREAGIEKELVISQLGMALYGVESDNISRIVIAYEPVWAIGTGKTA
RSSDAEEMHRSIREYIRSKYGRKIANNVRIIYGGSVKPDNISDLMSMPNIDGALVGGASL
KFESFAKIISY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagaagatctttgattgcagcgaattggaagatgaatctaacttttgatgacgctctt
tcatttgtaagttcttttaaggaatttaaatttgatacaaaaaagatagatgttttgatc
gcaccaccatttccatatctatcggatcttgggaaggctctaaaaaaaataaataaaaag
attattttgtcagcccaaaatatccatttcgaatcatctggagcttatactggtgaagta
tctgcggagatgttgaaatctattggtatcaattggactattatcggacattcggagagg
agacagtactttggggataccgacattattgtaaacaaaaaggttaaaaaggctctcgag
aatggattaaatgttattctttgtgttggggagcaactcccagagagggaggctggcatt
gaaaaagagcttgtgataagtcagcttgggatggcactttatggtgtggaaagtgataat
atctccagaatagttatagcttatgagcctgtttgggctatagggacgggcaagacagcc
agatcttcagatgccgaagagatgcacaggtccattagggaatatataagaagtaagtat
ggaagaaaaattgccaataatgtaagaattatttatggtggaagtgtaaagcctgacaat
atctcagatcttatgagtatgccaaacattgatggtgcactggtgggtggggcaagtcta
aaatttgaaagttttgctaaaattataagttattga

DBGET integrated database retrieval system