KEGG   Calditerrivibrio nitroreducens: Calni_1374Help
Entry
Calni_1374        CDS       T01364                                 

Definition
DNA replication and repair protein recr
Orthology
K06187  
recombination protein RecR
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Calni_1374
DNA repair and recombination proteins [BR:cni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Calni_1374
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1433371..1433973
Genome map
AA seq 200 aa AA seqDB search
MIYSKSFDRCIKELSKLPGIGKKTALRLSMQLLKMNQKDVEDIANAIIDLKKNTKFCIRC
GAMAEGEVCPICTDNNRDKQIICVVEEAKDVFLIEVSGKYNGVYHVLGGRLAPLDGINPD
DLRIKELLERIREDQVKEVILATNPDVEGDTTAIFLKKLISKNFDIKVTRIATGVPIGGY
LEYTDEITILKSLENRREML
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgatctattccaaatctttcgatagatgcataaaagagctatcaaaattacccggtatt
gggaaaaagacagctttacgattatcgatgcaacttttaaagatgaaccaaaaagatgtt
gaggatatcgcaaatgctatcatagatcttaaaaaaaatacaaaattctgtatcaggtgt
ggtgcaatggcggagggggaagtatgtccaatctgcaccgataacaaccgtgataagcag
ataatttgtgttgtggaagaggcaaaggatgtttttttaatcgaagtatcaggtaagtac
aacggtgtatatcatgtattgggaggtagacttgccccccttgatggtataaaccctgat
gatttgagaataaaagagcttcttgaaagaataagagaagatcaagtaaaagaagttatt
ctagccacaaacccagacgtggagggggatactacggcaatattcttaaaaaagttgata
agtaaaaattttgatattaaggttacaagaatagccaccggtgttccaattggaggttat
cttgaatatactgacgaaattaccatattaaaatcacttgagaatagaagagagatgttg
taa

DBGET integrated database retrieval system