KEGG   Calditerrivibrio nitroreducens: Calni_1381Help
Entry
Calni_1381        CDS       T01364                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain ii
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Calni_1381
   00030 Pentose phosphate pathway
    Calni_1381
   00051 Fructose and mannose metabolism
    Calni_1381
   00052 Galactose metabolism
    Calni_1381
   00500 Starch and sucrose metabolism
    Calni_1381
   00520 Amino sugar and nucleotide sugar metabolism
    Calni_1381
  Nucleotide metabolism
   00230 Purine metabolism
    Calni_1381
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Calni_1381
Enzymes [BR:cni01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Calni_1381
    5.4.2.8  phosphomannomutase
     Calni_1381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1438696..1440117
Genome map
AA seq 473 aa AA seqDB search
MVEKKIFRQYDIRGVVPDQFNPEILKIIGNTFGQNLKKKLNKVPVVSVGRDVRLSSNDLF
KGLTAGLTDAGCDVINLGTTPTPVTYFSSFKLHTDAFMMITGSHNPPEYNGLKFGIGKDT
VHSEGITDLYNDIINGQYLITDKRGNIKDYDIISDYIQFYEENFTELKQKIRTIKGVKVV
IDAGNGAASLVAPKIFELLGVDVVKLYCEPDGRFPNHHPDPTVEENLDDAKEVVKIDKAD
FAVAFDGDADRIGVLDESGNIIWGDILLYIYARELKERYEKPKIIADVKSSKLLFDMLDN
IGAEGIMWKTGHSLIKQKLKETGAELAGEMSGHIFFKDRFFGFDDAIYAAVRFLEAYVEN
KLEGKIEKCSDLTKDLPKVYNTPEIRFECDDNKKFKIVEQLSEIFNEYLKNGKLGIKSII
SIDGVRVNFDNGWGLIRASNTQPVLVMRFEAENIEAMNNYKKIFEAELSKIKI
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggtggaaaaaaagatattcagacaatacgatatcagaggagttgtacctgatcaattt
aatccagagattctaaaaattatcggtaatacctttggacaaaatttgaaaaagaaacta
aacaaagtaccagttgtttctgttggaagggatgtgagattatcctcaaatgaccttttc
aaagggctcacagctggacttaccgatgccggctgcgatgtgataaatttaggcactacc
cctacacctgtgacatatttttcttcattcaaactacataccgatgcctttatgatgatc
accggaagccacaacccacctgaatataatggattaaagtttggaattggcaaagatact
gtacattctgaggggatcacagatttatacaatgatatcattaatggacaatatctaatt
actgacaaaagaggaaatataaaagattacgacatcatttcagattatatacagttttac
gaagaaaactttaccgaattaaaacaaaagatcagaacaatcaaaggtgtaaaggttgta
atcgatgctggaaatggtgctgcctcccttgtggctcctaaaatatttgaacttctcggt
gtcgatgtggtaaaactatactgtgagccggatggtagattccccaatcatcaccctgat
cctacggtagaggaaaaccttgatgatgcaaaggaagtagtaaaaatagataaagcagat
tttgcagttgcattcgatggggatgcggataggataggagttttagatgaatctggcaat
attatatggggcgatattcttctttatatttacgccagagaactgaaagaaagatacgaa
aaacctaaaattatagctgatgtaaaatcatcaaaactgttatttgatatgctggataat
ataggtgctgaagggataatgtggaaaacaggtcactctttgataaagcagaaattaaaa
gagacaggtgccgaacttgctggagaaatgagtggacatatattttttaaagatcgattt
ttcggctttgatgatgcaatctacgctgcggtaagatttcttgaagcctatgttgagaat
aaattagaagggaaaatagagaaatgctcagatttgacaaaagatcttccaaaagtatat
aatacacctgaaattagatttgaatgtgatgataataaaaaatttaaaattgtggagcaa
ttatcggaaatttttaatgaatacctaaaaaatggcaagttggggataaaatcgattata
tcgatagatggtgttcgcgtaaactttgacaatggatgggggctcatcagggcaagcaat
actcagccggttcttgtgatgcgttttgaagcagaaaatatagaagctatgaacaattat
aaaaagatctttgaagctgagcttagtaaaataaagatatag

DBGET integrated database retrieval system