KEGG   Calditerrivibrio nitroreducens: Calni_1478Help
Entry
Calni_1478        CDS       T01364                                 

Definition
class ii aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Calni_1478
Enzymes [BR:cni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Calni_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1542371..1542919)
Genome map
AA seq 182 aa AA seqDB search
MVKKDIIKFGKKIVEQKLATSFFGNLSIKVSDELFITKTGTMLDELSEDDIVKVNLFEKG
EFDSVASSELIVHRMIYQKTSANAVMHTHSLYSILMGNTAFDYLKIDTGEALPFLNTIPI
VQGKSGSEELALTVSNALENFNLVIVKDHGVFAKGENLKSCFIYISALEHYCKYIYLKGL
LK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaaaagatataattaagtttggaaagaagatagtagaacaaaagctggcaaca
tccttttttggtaatctttcaattaaagtttctgatgaattatttattacaaaaaccgga
acaatgcttgacgaactatcagaggatgatattgtaaaagtgaatctttttgaaaaggga
gagtttgatagtgttgcatcttctgagttgatagtccatcggatgatatatcaaaaaaca
tcagctaatgctgtaatgcatacacattcactttattctattttaatggggaatactgct
tttgattatcttaaaatcgacacaggtgaagctttaccatttctaaacacgatccccata
gtacagggtaaaagtggatctgaagaattggcgctgactgtatcaaacgcattggagaat
tttaatctcgtgattgttaaagatcacggggtatttgcaaaaggggaaaatttgaaaagt
tgttttatctatatttctgctctggagcattattgtaagtatatatatttaaaaggtctt
ttaaaatga

DBGET integrated database retrieval system