KEGG   Calditerrivibrio nitroreducens: Calni_1618Help
Entry
Calni_1618        CDS       T01364                                 

Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00730  Thiamine metabolism
cni00790  Folate biosynthesis
cni01100  Metabolic pathways
cni02020  Two-component system
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Calni_1618
   00790 Folate biosynthesis
    Calni_1618
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Calni_1618
Enzymes [BR:cni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Calni_1618
Exosome [BR:cni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Calni_1618
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cni00537]
 Enzymes
  Calni_1618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme TAT_signal Sulfatase Phosphodiest Tex_N HTH_41
Motif
Other DBs
NCBI-ProteinID: ADR19525
JGI: Calni_1618
UniProt: E4TFF2
Position
1670133..1671677
Genome map
AA seq 514 aa AA seqDB search
MKRRDFLKISAAAGILMATSNELLAKRMEPAKGHGIIFIVGDGMPLGVMKGMKTVFEKDM
NYQSSIYSLLTDPKSIISLQNTSSLSSVVTDSAPASVAWGAGSKTVNRSLSVLPDGRNLK
TILELAKENGLSCGVVTTTRLTHATPAAWYSHDSNRDNEDRIAEDLLNLKLDVALGGGDK
HFNPTTRKDKMDLYSKFVENGYDVVKTKKELIDGFNSSKPLLGVFNKSHLSYYVDRLNDK
TLGEKQPDLSEMTLAALNRLSKNPKGFILQIEAGRIDHASHANDAWGAIMDCYELDKTVA
TVMEYIKKNPRTLLIITSDHGNSGWGINGSGPEYNDSTEGLFFYKNNKASFEYMIKLMKN
KDLKTVKDIFEEYTTTKITDAEAEAIYNGLNNKREFVINDQWYEPEATMGRILASSKYTA
NGEKLSKPAILRRGNVNWTSTNHTAEDQIVITYGHLSHQLDIRNYIDNTDLFKYMTKFFK
INYKNPQMTADEARSFLKSVSLKEWQEHLKLHIS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagagattttcttaagatttcagcagcagctggtatattgatggccaccagc
aatgaactgcttgcaaaaaggatggagccagcaaaaggacacggcattatttttatcgtt
ggagacggtatgcctctgggggtgatgaaggggatgaaaactgtatttgaaaaagacatg
aattatcaatcaagtatctattccctactgaccgatccaaaatctataatctctttacaa
aacacaagctcattatcaagcgttgtgaccgattcagctccggcctctgtggcatggggt
gcaggttccaaaacggtcaacagatctctatcggtattacctgatggtagaaacctgaaa
acgatacttgaattagctaaagaaaatggtttatcctgcggagttgtcacaaccacaaga
ctcactcatgccacaccagccgcatggtattcccatgattccaacagagataacgaagac
agaattgctgaagatttacttaatttaaaacttgatgtggctcttggtggtggagataag
cattttaaccccacaacaagaaaagataaaatggatctttacagcaaatttgttgaaaat
ggctacgatgtagtaaaaacaaagaaagaacttatcgatgggttcaattcatcaaagcca
ttactgggagtatttaataaatcccatttaagctactatgtagatagattaaacgataaa
actcttggtgaaaaacaacccgatctatcagaaatgactcttgcagcgttaaacaggcta
tcaaaaaatccaaaaggtttcatacttcaaatagaagccggaagaatcgatcacgcctcc
catgctaatgacgcctggggggccataatggactgctatgaacttgataaaacggtagca
actgtaatggaatacattaaaaagaatcccagaaccctcctgattataacatcagaccac
ggaaattcaggttgggggataaatggttcagggccagagtataatgattctactgagggg
cttttcttctataaaaacaacaaagcatcgtttgagtatatgataaaattgatgaaaaat
aaagatctgaagacagtgaaggatatttttgaagaatacaccaccacaaaaattacagat
gcagaagccgaggcaatatacaacggacttaataataagagagaatttgtaattaacgat
cagtggtatgaaccggaagcaacgatgggtagaatacttgccagcagtaaatataccgca
aatggtgaaaaactctcaaagcctgcaattttaagaagagggaatgtaaactggacatcc
acaaatcacacagctgaagatcaaatagtcattacttatgggcacctttctcatcaactg
gatatcaggaactacattgacaacactgatttatttaagtacatgacaaaattcttcaaa
attaactataaaaatccccagatgacagcagatgaggcaagatcctttctaaaatctgtt
tcattaaaagaatggcaggaacatctaaaattacacatatcctga

DBGET integrated database retrieval system