KEGG   Calditerrivibrio nitroreducens: Calni_1618Help
Entry
Calni_1618        CDS       T01364                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cni00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:cni00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:cni02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1670133..1671677
Genome map
AA seq 514 aa AA seqDB search
MKRRDFLKISAAAGILMATSNELLAKRMEPAKGHGIIFIVGDGMPLGVMKGMKTVFEKDM
NYQSSIYSLLTDPKSIISLQNTSSLSSVVTDSAPASVAWGAGSKTVNRSLSVLPDGRNLK
TILELAKENGLSCGVVTTTRLTHATPAAWYSHDSNRDNEDRIAEDLLNLKLDVALGGGDK
HFNPTTRKDKMDLYSKFVENGYDVVKTKKELIDGFNSSKPLLGVFNKSHLSYYVDRLNDK
TLGEKQPDLSEMTLAALNRLSKNPKGFILQIEAGRIDHASHANDAWGAIMDCYELDKTVA
TVMEYIKKNPRTLLIITSDHGNSGWGINGSGPEYNDSTEGLFFYKNNKASFEYMIKLMKN
KDLKTVKDIFEEYTTTKITDAEAEAIYNGLNNKREFVINDQWYEPEATMGRILASSKYTA
NGEKLSKPAILRRGNVNWTSTNHTAEDQIVITYGHLSHQLDIRNYIDNTDLFKYMTKFFK
INYKNPQMTADEARSFLKSVSLKEWQEHLKLHIS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaagagattttcttaagatttcagcagcagctggtatattgatggccaccagc
aatgaactgcttgcaaaaaggatggagccagcaaaaggacacggcattatttttatcgtt
ggagacggtatgcctctgggggtgatgaaggggatgaaaactgtatttgaaaaagacatg
aattatcaatcaagtatctattccctactgaccgatccaaaatctataatctctttacaa
aacacaagctcattatcaagcgttgtgaccgattcagctccggcctctgtggcatggggt
gcaggttccaaaacggtcaacagatctctatcggtattacctgatggtagaaacctgaaa
acgatacttgaattagctaaagaaaatggtttatcctgcggagttgtcacaaccacaaga
ctcactcatgccacaccagccgcatggtattcccatgattccaacagagataacgaagac
agaattgctgaagatttacttaatttaaaacttgatgtggctcttggtggtggagataag
cattttaaccccacaacaagaaaagataaaatggatctttacagcaaatttgttgaaaat
ggctacgatgtagtaaaaacaaagaaagaacttatcgatgggttcaattcatcaaagcca
ttactgggagtatttaataaatcccatttaagctactatgtagatagattaaacgataaa
actcttggtgaaaaacaacccgatctatcagaaatgactcttgcagcgttaaacaggcta
tcaaaaaatccaaaaggtttcatacttcaaatagaagccggaagaatcgatcacgcctcc
catgctaatgacgcctggggggccataatggactgctatgaacttgataaaacggtagca
actgtaatggaatacattaaaaagaatcccagaaccctcctgattataacatcagaccac
ggaaattcaggttgggggataaatggttcagggccagagtataatgattctactgagggg
cttttcttctataaaaacaacaaagcatcgtttgagtatatgataaaattgatgaaaaat
aaagatctgaagacagtgaaggatatttttgaagaatacaccaccacaaaaattacagat
gcagaagccgaggcaatatacaacggacttaataataagagagaatttgtaattaacgat
cagtggtatgaaccggaagcaacgatgggtagaatacttgccagcagtaaatataccgca
aatggtgaaaaactctcaaagcctgcaattttaagaagagggaatgtaaactggacatcc
acaaatcacacagctgaagatcaaatagtcattacttatgggcacctttctcatcaactg
gatatcaggaactacattgacaacactgatttatttaagtacatgacaaaattcttcaaa
attaactataaaaatccccagatgacagcagatgaggcaagatcctttctaaaatctgtt
tcattaaaagaatggcaggaacatctaaaattacacatatcctga

DBGET integrated database retrieval system