KEGG   Calditerrivibrio nitroreducens: Calni_1635Help
Entry
Calni_1635        CDS       T01364                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Calni_1635
   00052 Galactose metabolism
    Calni_1635
   00500 Starch and sucrose metabolism
    Calni_1635
   00520 Amino sugar and nucleotide sugar metabolism
    Calni_1635
Enzymes [BR:cni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Calni_1635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1692526..1693383)
Genome map
AA seq 285 aa AA seqDB search
MKIRKAVFPVAGFGTRMLPATKAIPKEMITLVDKPLIQYAVEEAVEAGIEEIIFITGRFK
RAIEDHFDKSIELEIALKESKKEKEYEILSKISEMCDFITVRQKEQKGLGHAIYCARDVL
GKDPFVVILPDDIISYKESVTGQLIKKFEEFGSPVLAITEVPAEETYKYGIVDIEKKMDE
RTFKLKGMVEKPKSNPPSNYAIIGRYVLTYDVLKAIEECDTNQGEIQLTDAIRKVTKDQS
SYGYLYDGLRFDCGNKIGYLDATIHFALNRDDLKDDFTKILKKYC
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcgaaaagctgtttttccggttgccgggtttggtacaaggatgcttccggct
accaaggcgatacctaaggagatgattacgcttgttgataaacctttgattcaatatgct
gtggaagaagcggtggaggcaggtattgaggagattatatttataacagggagattcaaa
agagctatagaggaccattttgataaatctatagagcttgaaattgctctaaaagaatcg
aaaaaagagaaggaatatgagatcctttcaaaaataagtgagatgtgtgatttcatcacc
gtaaggcagaaagaacaaaaaggcttaggtcatgcgatatactgtgccagagatgtgttg
gggaaggatccttttgtggtgatactgccggacgatatcataagctacaaagaatctgtt
accggacagcttatcaaaaagtttgaagagtttggatcacctgtactcgcaattacagag
gttcctgctgaagagacttataaatacggtatagttgatattgagaaaaaaatggatgaa
agaacttttaagttaaaagggatggtggaaaagcctaaaagtaaccctccttctaattat
gcaataattggtcggtatgtattgacctatgatgttttgaaagccattgaagaatgtgat
acaaatcagggtgaaattcagcttaccgatgcgatacgcaaagttacaaaagatcagagt
agctatggttatctttatgacggtttaagatttgattgtggaaataagattggctatctt
gatgccacaatccattttgcattaaatagagatgatttgaaagatgattttacaaaaatt
ttgaaaaaatattgttga

DBGET integrated database retrieval system