KEGG   Calditerrivibrio nitroreducens: Calni_1690Help
Entry
Calni_1690        CDS       T01364                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
cni00760  Nicotinate and nicotinamide metabolism
cni01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Calni_1690
Enzymes [BR:cni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Calni_1690
    3.5.1.-  
     Calni_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ADR19596
JGI: Calni_1690
UniProt: E4TFU0
Position
complement(1740545..1741081)
Genome map
AA seq 178 aa AA seqDB search
MKALLIVDLQNDFCPGGALPVPDGDKIVPVINSIMDRFDLVVSSQDWHPDKGEHFDKWPP
HCLQNTKGADFHPDLRADKIDIKLLKGTDGSDTGYSAFEATNIDLVKLLKERDIDKLYIT
GLATEYCVKATAIDALKNGFNTFLIVDATKGLDEAKSKKTIEELEKIGVKSVISAEIL
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctcttctgatagttgatctacaaaacgatttttgtccaggtggtgcccttccc
gtgccggatggggataagattgtccctgtgataaattcgattatggataggtttgatctt
gtggtatccagccaggactggcatcctgataaaggggaacactttgataaatggccacca
cattgccttcagaataccaaaggggcagattttcatccagatttaagagcagataaaata
gatataaaactattaaaaggtactgatggatctgatacaggttattccgcttttgaagct
accaatattgatcttgtgaagttgctaaaagaaagagatatagataagctctacatcaca
gggcttgctacggaatactgtgtaaaagctacggctattgatgctctaaaaaatggattt
aatacatttttaatcgtggatgccacaaaaggccttgatgaagcaaaatcgaaaaaaaca
attgaagagctggaaaagatcggggttaagtctgtaatttctgcggaaatattatag

DBGET integrated database retrieval system