KEGG   Calditerrivibrio nitroreducens: Calni_1980Help
Entry
Calni_1980        CDS       T01364                                 

Definition
uroporphyrinogen iii synthase hem4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cni00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2053046..2053762)
Genome map
AA seq 238 aa AA seqDB search
MPGRKILITRQPEMSVEFINKLSYNRLYPYILPMIKTVPHSIIISEMMYDFVIVTSRNAC
NYIQPFMDKLFYSRAIAVGEKTKQCMEMVGFRDVEVPKTFSQKGIINYLSGEDIKGKRFF
LPGAEERPDELIRFLTEKGAIVDAPTLYTTEKICYQQDYITDFLNEIHIDAVTFLSPSAA
KGFFSQVTFSKIKKVPLFVSIGPTTHDYLMSIGIESIYPKTYFSVDGIVDLLVSIFKS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtcgtaaaattctcataacaagacaaccggagatgtctgtagaatttatcaat
aaactatcttacaatagactttatccttatatccttccgatgatcaaaacggtaccccat
tcgataattataagcgagatgatgtatgattttgtgattgtgaccagcagaaatgcctgc
aactatattcagccatttatggataagttgttttattcaagggcaattgcggtgggggaa
aagacaaaacaatgtatggaaatggtggggtttagagatgtagaggtgccaaaaaccttc
tcccaaaaagggattattaactacctgtctggtgaagatatcaagggtaaacggtttttt
ctccctggtgctgaagagagacctgatgagctgataaggttcctcactgaaaaaggtgca
atagtggatgcccccactttgtatacaacagaaaagatctgttatcagcaggattatatt
accgattttttaaatgaaatacatatcgatgcagtcacatttttatccccatcggccgcc
aaagggtttttcagtcaggtgactttttccaaaatcaaaaaggttcctctttttgtttcg
atagggcccactacccacgattatctgatgagcattgggatagaatcgatctatcccaaa
acctatttttcagttgatgggattgtggatcttttggtttctatcttcaaatcatga

DBGET integrated database retrieval system