KEGG   Calditerrivibrio nitroreducens: Calni_2017Help
Entry
Calni_2017        CDS       T01364                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Calni_2017
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Calni_2017
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Calni_2017
Enzymes [BR:cni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Calni_2017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2090232..2091590
Genome map
AA seq 452 aa AA seqDB search
MSKIYLKPEEMPKKWYNILADLPTPMDPPISPFTGKPVTFDEMKAIFPPHLIEQEMSDKK
WIDIPDEVLEVLSIWRPSPLIRAKRLEEVLGTTAKIYYKYEGVSPAGSHKPNTAVAQAYY
NKINGIKRLTTETGAGQWGSALSLACKMFDIACRVYMVKVSYHQKPYRKSFMRLFGAEVI
PSPSDITNAGREVLKRNPNSNGSLGIAISEAVEEAAQRSDTNYALGSVLNHVLLHQTVIG
LEAIKQFELVGDYPDKIYASCGGGSNFGGIAFPFLEKMLKGDKKTEAIAVEPASCPTLTK
GVFEYDYGDEAKLTPIMKMYTLGHDFEPPAIHAGGLRYHGDSPIVSYLYNKGLIGAEAVH
QSEVFEAGILFAQTEAIVPAPESSHAIAAAIKEAKRCKETGESKTILFCLSGHGFFDMGS
YDAYLDGKLSDFEYPEEAIKESLKNLPNVSLK
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatatatctaaagcctgaagagatgccaaaaaaatggtacaacatattagct
gacctacctacaccgatggatccacccatcagccctttcaccggcaaaccggtcaccttt
gatgagatgaaagccatctttcctccccaccttatagagcaggagatgtcggataaaaaa
tggatagatatacctgatgaggtgttggaggtgttgtccatctggaggccttcaccgcta
ataagggccaaaagattggaggaggtgctgggaacaactgcaaaaatctactacaaatat
gaaggggtttccccggcggggagtcataaaccgaataccgccgtagcccaggcttattac
aataaaataaacggtattaagcgattaaccaccgaaaccggagctgggcaatggggaagt
gccctttctctggcatgtaagatgtttgatattgcctgtcgggtatatatggtaaaagtt
agctaccatcagaaaccataccgtaaatcttttatgagactatttggggcagaggttatc
cccagcccatcagacatcaccaatgctggaagagaagtattaaagagaaatcccaattct
aatggctctctgggtatagcaatcagtgaagcagtggaggaagcagcccagagaagtgat
acaaattatgcactgggtagcgttctaaatcacgttcttcttcaccaaacggttatcggt
cttgaagccatcaaacagttcgagctggtgggggattaccctgataaaatatacgcatcc
tgtggtggaggatccaattttggtggaatagcatttccatttcttgaaaagatgttaaaa
ggggataaaaagaccgaagccatagctgttgagcccgcaagctgccccacattaacaaaa
ggtgtatttgaatacgactacggcgacgaagcaaagcttaccccaataatgaagatgtat
actcttggccacgattttgaaccaccagccatccatgcgggaggtttgagataccatgga
gattccccaattgtaagttatctttacaataaaggattaatcggtgcagaagcagttcat
caatctgaagtatttgaagcaggcattctatttgctcaaacagaggctatagtccctgca
ccagaatcttctcatgccattgcggcagccataaaggaagcaaaaagatgcaaagagact
ggtgaatccaaaactattcttttctgtttgagcggacatggtttttttgatatgggctct
tatgatgcatatcttgatggaaaattatctgactttgaatatccggaagaggccataaaa
gaatctttgaagaacctacctaatgtgagcttaaaatag

DBGET integrated database retrieval system