KEGG   Calditerrivibrio nitroreducens: Calni_2047Help
Entry
Calni_2047        CDS       T01364                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:cni00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Calni_2047
Enzymes [BR:cni01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.24  glutamate---tRNAGln ligase
     Calni_2047
Amino acid related enzymes [BR:cni01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Calni_2047
Transfer RNA biogenesis [BR:cni03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Calni_2047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2126902..2128362
Genome map
AA seq 486 aa AA seqDB search
MSIRVRFAPSPTGHIHVGNARTALFNYLFAKKNNGVFILRIEDTDLERSTLESENIIYED
LKWLGLDWDEGPIVGGDFGPYRQSERLHIYEEYVKKLMAEGFAYECFCTKDELEAEREKA
KAEGRQPIYNGKCRNLSNEEKIRLKNSGVKPSIRFHVKEKEVLVKDFIKGDVLFPTDTFG
DFVIVRPDGIPTYNFAVVIDDALMKITHVIRGDDHLNNTPKQILIFNALNFKLPIFVHIP
MILGSDHSKLSKRHGDTSLNLFKDKGYLPEAMFNFLALLSWSAPDDKEIMSKEEIISLFT
LDRISRSSAVFDFAKLKWMNGHYIRNLDIDRLVSEAIPFLEKAGLLTEGFKNRYKDKIPE
MIFSLREKFEIFTELPDLFKVYTEFNEDLDGEAVELLKLPTSRTVLEAFRDAILGKTYIT
IDEYKRITGEIQKSVGVKGKALFMVIRVGITGLTKGADLDKIVTLLSVEDLKQRLDKALK
IMSQIC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataagagttagatttgcccccagccccacgggacatattcatgtgggtaatgcc
agaacagcgctttttaattatcttttcgctaaaaaaaataatggtgtttttatcttaaga
atagaagataccgatcttgaaagatccactttagaatctgaaaatatcatatatgaagac
ctaaaatggcttggacttgattgggatgaggggcctattgtggggggtgattttggccca
tataggcagagtgagaggctacatatatatgaagagtatgtaaaaaaactcatggcagaa
ggcttcgcttatgagtgtttttgcaccaaagatgaactggaggctgaaagagaaaaagca
aaagcagaaggaagacaacctatttataatggaaaatgcagaaaccttagtaatgaagag
aaaattagacttaaaaatagtggtgttaagccctccataaggtttcatgtgaaagagaaa
gaggttcttgtgaaagactttataaaaggggatgtattattccccactgatacatttgga
gattttgttattgttcgtcctgacggcatccccacttacaattttgcggttgtaatagat
gacgcactgatgaagataacccacgttataagaggagatgatcatctaaataatacacca
aaacagatccttatatttaatgctctgaatttcaaactacctatatttgtgcatatcccg
atgattttgggaagtgatcattccaaactaagtaaaagacatggggatacctcccttaac
cttttcaaagataaaggctatctgccagaggctatgtttaattttctggctcttctcagc
tggtcagcacctgatgataaagaaattatgtcaaaagaggagattatatcgctgtttaca
cttgatagaatatccagaagctcagcagtattcgattttgcgaaacttaaatggatgaat
ggtcattacatcagaaaccttgacatagatcgcttagtctctgaagccataccttttctg
gaaaaagctggacttttgacagaaggttttaagaatagatacaaagacaaaattccagaa
atgatcttttcactgagggaaaagtttgaaatctttaccgagcttccggatcttttcaaa
gtttatactgaatttaatgaagacttagatggtgaagcggtggaacttttaaaactaccc
acgtcaagaaccgttctggaagcttttagagacgccatattagggaaaacatatattaca
attgatgaatacaaaaggattacaggagaaatccagaagtcagtgggtgtaaaagggaag
gcactttttatggtcataagagtagggattacagggcttactaaaggtgcagacctggat
aagatagttacccttctttcggttgaagatctcaaacagagattggataaggcgcttaaa
ataatgagccagatatgttga

DBGET integrated database retrieval system