KEGG   Calditerrivibrio nitroreducens: Calni_2047Help
Entry
Calni_2047        CDS       T01364                                 

Definition
glutamyl-tRNA synthetase (EC:6.1.1.17)
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
cni  Calditerrivibrio nitroreducens
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:cni00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2126902..2128362
Genome map
AA seq 486 aa AA seqDB search
MSIRVRFAPSPTGHIHVGNARTALFNYLFAKKNNGVFILRIEDTDLERSTLESENIIYED
LKWLGLDWDEGPIVGGDFGPYRQSERLHIYEEYVKKLMAEGFAYECFCTKDELEAEREKA
KAEGRQPIYNGKCRNLSNEEKIRLKNSGVKPSIRFHVKEKEVLVKDFIKGDVLFPTDTFG
DFVIVRPDGIPTYNFAVVIDDALMKITHVIRGDDHLNNTPKQILIFNALNFKLPIFVHIP
MILGSDHSKLSKRHGDTSLNLFKDKGYLPEAMFNFLALLSWSAPDDKEIMSKEEIISLFT
LDRISRSSAVFDFAKLKWMNGHYIRNLDIDRLVSEAIPFLEKAGLLTEGFKNRYKDKIPE
MIFSLREKFEIFTELPDLFKVYTEFNEDLDGEAVELLKLPTSRTVLEAFRDAILGKTYIT
IDEYKRITGEIQKSVGVKGKALFMVIRVGITGLTKGADLDKIVTLLSVEDLKQRLDKALK
IMSQIC
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataagagttagatttgcccccagccccacgggacatattcatgtgggtaatgcc
agaacagcgctttttaattatcttttcgctaaaaaaaataatggtgtttttatcttaaga
atagaagataccgatcttgaaagatccactttagaatctgaaaatatcatatatgaagac
ctaaaatggcttggacttgattgggatgaggggcctattgtggggggtgattttggccca
tataggcagagtgagaggctacatatatatgaagagtatgtaaaaaaactcatggcagaa
ggcttcgcttatgagtgtttttgcaccaaagatgaactggaggctgaaagagaaaaagca
aaagcagaaggaagacaacctatttataatggaaaatgcagaaaccttagtaatgaagag
aaaattagacttaaaaatagtggtgttaagccctccataaggtttcatgtgaaagagaaa
gaggttcttgtgaaagactttataaaaggggatgtattattccccactgatacatttgga
gattttgttattgttcgtcctgacggcatccccacttacaattttgcggttgtaatagat
gacgcactgatgaagataacccacgttataagaggagatgatcatctaaataatacacca
aaacagatccttatatttaatgctctgaatttcaaactacctatatttgtgcatatcccg
atgattttgggaagtgatcattccaaactaagtaaaagacatggggatacctcccttaac
cttttcaaagataaaggctatctgccagaggctatgtttaattttctggctcttctcagc
tggtcagcacctgatgataaagaaattatgtcaaaagaggagattatatcgctgtttaca
cttgatagaatatccagaagctcagcagtattcgattttgcgaaacttaaatggatgaat
ggtcattacatcagaaaccttgacatagatcgcttagtctctgaagccataccttttctg
gaaaaagctggacttttgacagaaggttttaagaatagatacaaagacaaaattccagaa
atgatcttttcactgagggaaaagtttgaaatctttaccgagcttccggatcttttcaaa
gtttatactgaatttaatgaagacttagatggtgaagcggtggaacttttaaaactaccc
acgtcaagaaccgttctggaagcttttagagacgccatattagggaaaacatatattaca
attgatgaatacaaaaggattacaggagaaatccagaagtcagtgggtgtaaaagggaag
gcactttttatggtcataagagtagggattacagggcttactaaaggtgcagacctggat
aagatagttacccttctttcggttgaagatctcaaacagagattggataaggcgcttaaa
ataatgagccagatatgttga

DBGET integrated database retrieval system