KEGG   Clostridium novyi: NT01CX_0146Help
Entry
NT01CX_0146       CDS       T00431                                 

Gene name
porD
Definition
(GenBank) pyruvate synthase subunit porD
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cno  Clostridium novyi
Pathway
cno00010  Glycolysis / Gluconeogenesis
cno00020  Citrate cycle (TCA cycle)
cno00620  Pyruvate metabolism
cno00633  Nitrotoluene degradation
cno00640  Propanoate metabolism
cno00650  Butanoate metabolism
cno00680  Methane metabolism
cno01100  Metabolic pathways
cno01120  Microbial metabolism in diverse environments
cno01130  Biosynthesis of antibiotics
cno01200  Carbon metabolism
Module
cno_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_0146 (porD)
   00020 Citrate cycle (TCA cycle)
    NT01CX_0146 (porD)
   00620 Pyruvate metabolism
    NT01CX_0146 (porD)
   00640 Propanoate metabolism
    NT01CX_0146 (porD)
   00650 Butanoate metabolism
    NT01CX_0146 (porD)
  Energy metabolism
   00680 Methane metabolism
    NT01CX_0146 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NT01CX_0146 (porD)
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NT01CX_0146 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_6 Fer4_21 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_4 Fer4_16 Fer4_18 Fer4_13 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ABK62307
UniProt: A0Q203
Position
complement(1799191..1799493)
Genome map
AA seq 100 aa AA seqDB search
MELSKKMNVTSESKWNEIPIGGQIVDAGNSEEFKTGDWRAMKPVWHEDKCKNCMFCWAVC
PDMSIIVKDGKVTGIDYDHCKGCGVCTKQCKFNALDFVAE
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggaattgagtaaaaaaatgaatgttacttcagaaagtaagtggaatgaaataccaata
ggcggacaaattgttgatgcaggtaattctgaagagtttaaaactggtgattggagagct
atgaagcctgtatggcatgaagataaatgtaaaaattgtatgttttgttgggctgtatgt
cctgatatgtccattatagttaaagacggaaaggtaacaggcattgattatgatcattgt
aagggatgtggagtttgtacaaaacaatgtaaatttaatgctttagattttgtagcggaa
taa

DBGET integrated database retrieval system