KEGG   Clostridium novyi: NT01CX_0146Help
Entry
NT01CX_0146       CDS       T00431                                 

Gene name
porD
Definition
(GenBank) pyruvate synthase subunit porD (EC:1.2.7.1)
  KO
K00171  
pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
cno  Clostridium novyi
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01CX_0146 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_0146 (porD)
   00020 Citrate cycle (TCA cycle)
    NT01CX_0146 (porD)
   00620 Pyruvate metabolism
    NT01CX_0146 (porD)
   00640 Propanoate metabolism
    NT01CX_0146 (porD)
   00650 Butanoate metabolism
    NT01CX_0146 (porD)
  Energy metabolism
   00680 Methane metabolism
    NT01CX_0146 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NT01CX_0146 (porD)
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NT01CX_0146 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1799191..1799493)
Genome map
AA seq 100 aa AA seqDB search
MELSKKMNVTSESKWNEIPIGGQIVDAGNSEEFKTGDWRAMKPVWHEDKCKNCMFCWAVC
PDMSIIVKDGKVTGIDYDHCKGCGVCTKQCKFNALDFVAE
NT seq 303 nt NT seq  +upstreamnt  +downstreamnt
atggaattgagtaaaaaaatgaatgttacttcagaaagtaagtggaatgaaataccaata
ggcggacaaattgttgatgcaggtaattctgaagagtttaaaactggtgattggagagct
atgaagcctgtatggcatgaagataaatgtaaaaattgtatgttttgttgggctgtatgt
cctgatatgtccattatagttaaagacggaaaggtaacaggcattgattatgatcattgt
aagggatgtggagtttgtacaaaacaatgtaaatttaatgctttagattttgtagcggaa
taa

DBGET integrated database retrieval system