KEGG   Clostridium novyi: NT01CX_0374Help
Entry
NT01CX_0374       CDS       T00431                                 

Definition
bifunctional folate synthesis protein
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
cno  Clostridium novyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cno00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2063353..2064171)
Genome map
AA seq 272 aa AA seqDB search
MTVDKIYIEDLEVFANHGVYEEEKRLGQKFLISAEVFIDLQQAGLTDNLNETVNYGLLCC
EIEELFKKDSYDLLEKVAEQVADDILLRYEDIQRIKLKVKKPWAPIGKPIKHAAVEIDRS
KHTVYIGIGSNIGDKNKNLEKAIEKLKNTDLTKVTKVSKFYITKPYGYVEQDDFLNCAVE
VETLLNPGKLMKVLLDIEQQLKRKRTIKWGPRIIDLDILLYDDLILSNKETIIPHPLMHD
RMFVLEPLNEIAPYAFHPILNKRVFQLKEDLK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggataaaatatatatagaagatttagaggtatttgctaaccatggagtatat
gaagaagaaaaaaggttaggacaaaaatttttgatttctgctgaagtttttatagatttg
cagcaagcaggcttaactgataatttaaatgaaactgttaattatggattgttgtgttgt
gagattgaagagttatttaaaaaagatagctatgatctattagaaaaagtagccgagcaa
gttgcagatgatattttattaaggtatgaagatattcaaagaattaaactaaaagtaaaa
aagccttgggcacctataggaaagcctataaaacatgcggcagttgaaatagatagaagc
aagcatacagtttatattggaataggatcaaatataggtgataaaaataagaatctagaa
aaggctatagaaaaattaaaaaatactgatttaactaaggttactaaagtgtctaaattt
tatattacaaaaccttatggatatgtagaacaagatgattttttaaattgtgcagttgaa
gtagagacgcttcttaatccaggtaaacttatgaaagttttacttgatatagaacaacaa
ttaaagagaaaacgtacaattaaatggggacctagaattatagatttagatatattattg
tatgatgatttaattttatctaataaagaaacaataattcctcatccattaatgcatgat
agaatgtttgtattagagcctttaaatgaaatagctccatatgcatttcatcctatactt
aataaaagagtatttcaattaaaagaagatttaaaataa

DBGET integrated database retrieval system