KEGG   Clostridium novyi: NT01CX_0377Help
Entry
NT01CX_0377       CDS       T00431                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cno  Clostridium novyi
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cno00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2065527..2066084)
Genome map
AA seq 185 aa AA seqDB search
MIDYEKIKKAVIMIIEAIGEDPNREGLKETPDRIARMYEEIFSGIRETPEKHLSKVFKVN
NDDVVVEKDIQFYSMCEHHFLPFFGKVHIAYIPNGKVVGLSKLARTTEVFSKRPQLQERL
TSQIADSLMEYLKCKGAMVIIEAEHLCMSMRGVKKWGSKTTTIVTRGEFQKDNSLKQDVL
NILRL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgatagattatgagaagataaagaaggcagtgataatgataattgaagctattggagaa
gatccaaatagagaaggacttaaagaaacacctgataggatagcgagaatgtatgaagaa
atattttctggcattagagaaacgccagaaaaacacttaagtaaagtgtttaaagttaac
aatgatgatgtagtagtagaaaaagatattcaattttattctatgtgtgaacatcatttc
cttccgttctttggaaaggtgcatatagcttatattcctaatggaaaggtagttgggctt
agtaaattagcaagaactacagaggttttttctaagagaccccaattgcaagaaagatta
acatcacaaatagcagattcattaatggaatatttaaagtgtaaaggagcaatggtaatt
atagaagctgaacacttatgtatgagtatgaggggagttaaaaagtggggatcaaaaaca
actactatagttactagaggggagtttcaaaaagataactcacttaagcaagatgtttta
aatatacttagattataa

DBGET integrated database retrieval system