KEGG   Clostridium novyi: NT01CX_0605Help
Entry
NT01CX_0605       CDS       T00431                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cno  Clostridium novyi
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cno00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2285922..2287505)
Genome map
AA seq 527 aa AA seqDB search
MLKIFKRFRDIINQDHYEQVESTDISDLDVNGKYIMALDQGTTSSRCIIFNRAGEMVSVA
QREFAQIYPKPGWVEHDPMEIWGTQLGVAQEALNKAGLEVGDICSIGITNQRETTVVWNK
KNGRPVYNAIVWQCRRTAEYCDELKKEGFDKIIEEKTGLILDAYFSATKIKWILDNVPDA
RRLAERGDLMFGNVDTWLIWNLTKGRVHVTDYTNASRTMLYNIHELKWDEEILEKLDIPI
SMLPKVKSSSEVYGKTHPSVIGGLIPISGDAGDQQAALFGQMCFKEGMAKNTYGTGCFLL
MNTGDKAVKSKNGLLTTIAASRGEKVQYALEGSVFIGGAVIQWLRDEFRMIKTAAESEEY
ASAVEDSNGVYLVPAFVGLGAPYWDAYARGTMVGITRGAKKEHIIRAALESMAYQTYDVL
KAMEEDSGVELKALKVDGGACANNFLMQFQSDILNVNVQRPEIIETTALGAAYLAGLAVG
YWKDSEDIAVNCKIARTFEPLMEKEKREKFIKGWHKAINVSKGWEGK
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaatttttaagcgttttagagatattataaatcaagatcattatgagcaagta
gaaagtacagacataagtgatttagacgttaatggaaagtatataatggcattagatcaa
ggcacaacaagttcaagatgtattatctttaatagagctggagaaatggtatccgtagca
caaagagagtttgcacaaatatatccaaaacctggttgggttgaacatgatcctatggaa
atatggggaacacaactaggggttgcgcaagaagctttaaataaagctggactagaagtt
ggtgatatttgttctataggaataacaaatcaaagggaaactactgttgtttggaataag
aaaaatggtagacctgtttataatgctatagtttggcaatgtagaagaacggctgagtat
tgtgatgagttaaaaaaagaagggttcgataagataatagaggaaaaaacggggctaatt
ttagatgcttatttttcagcaactaaaataaaatggattttagataatgtacctgatgca
agaagattagctgaaagaggagacttaatgtttggaaatgtagacacatggttaatatgg
aatttaaccaagggaagagttcatgtaactgattacacaaatgcttcaagaactatgcta
tataatattcatgaattaaaatgggatgaagagatattagaaaaactagatataccaata
tcaatgttacctaaagttaaatcttcaagtgaggtttacggaaaaactcacccatcagta
atcggcggacttataccaatatcaggagatgctggagatcagcaagcggctttatttggg
caaatgtgttttaaagaaggtatggctaaaaatacctatggaactggctgtttcttatta
atgaatactggagataaagctgtaaaatcaaaaaatggacttcttacaacaatagcagct
tcaagaggggaaaaagtacaatatgctcttgaaggaagtgtatttataggtggagcagta
attcagtggttacgtgatgaatttagaatgataaaaacagcggctgaatcagaagaatat
gcaagtgcagttgaggattctaatggagtatatttagttccggcatttgttggacttgga
gcgccttattgggacgcatatgcaagaggaactatggtgggaattactagaggtgccaag
aaggaacatataattagagcggcattagagtctatggcatatcaaacttatgatgtttta
aaggctatggaagaagattcaggggtagaactaaaagctctaaaggtagacggtggagct
tgtgctaacaactttttaatgcaatttcaatcagatatattaaatgtaaatgtacaaaga
cccgaaatcatagagacaacggcattaggagctgcttatcttgcaggacttgctgtaggc
tactggaaagatagcgaagatatagcggttaactgtaagatagctagaacttttgagcct
ttaatggaaaaggagaaaagagaaaaattcattaaaggatggcataaagctattaatgta
tctaaaggttgggaaggtaagtaa

DBGET integrated database retrieval system