KEGG   Clostridium novyi: NT01CX_0723Help
Entry
NT01CX_0723       CDS       T00431                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase
Orthology
K00975  
glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
cno  Clostridium novyi
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cno00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cno00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2414865..2416013
Genome map
AA seq 382 aa AA seqDB search
MIKKEMLAMILAGGQGTRLKILTKNNAKPAVPFGGKYRIIDFTLSNCSNSGIDTIGVLTQ
YEPHILNSHIGIGSPWDLDRKRGGVSILPPHMRNDGGNWYMGTADAIYQNIMFIDKYDPE
YILVLSGDHIYKMDYSKMLQFHKEKNSDATIAVIDVPIEEASRFGIMNTNDDDKIYEFEE
KPEQPKNNKASMGIYIFNWKILKEFLIEDSELEDSDHDFGKNIIPSLLDSGYNLYAYSFN
GYWKDVGTIESLWQANMDLLDTKNPLDIYNKNWKIYSVSPSKPPQYTGPNAIIQNSLVVE
GCAVFGKIQNSVLFPEVEVGSNSIIQDSVIMSNVKIGQNVIIRKCIIGSNTIIENNSVIG
NSDDITVIGDGEKIKTNSIIKN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagaaatgttagccatgattcttgcagggggacaaggtactagactaaaa
attttaaccaaaaacaatgcaaaaccagcagtaccattcggcggtaagtatagaatcata
gattttaccttaagtaactgttctaactcaggaatcgacaccattggagtattgacacaa
tatgaacctcacatacttaattcccatataggtataggtagcccttgggatttagataga
aaaagaggcggagtttcaatccttcccccgcacatgagaaatgacggtgggaactggtat
atgggtaccgcagatgccatatatcaaaatataatgtttatagataaatatgatcctgaa
tatatattagttttatccggtgaccatatctataaaatggactattctaaaatgctacaa
tttcacaaagaaaaaaactcagatgccacaatagctgttattgacgttccaatagaagaa
gctagtcgtttcggcataatgaacaccaatgatgatgataaaatatatgaatttgaagaa
aaaccagaacaaccaaaaaacaataaagcttccatggggatatatattttcaactggaaa
atactcaaggaattcctaattgaagattcagaacttgaagattcagatcatgatttcggt
aaaaacataattccaagcctacttgattcaggttacaatctttatgcctattctttcaat
ggatactggaaagatgttggaaccatagaaagcttatggcaagccaatatggatttatta
gatactaaaaatccactagacatttataataaaaactggaaaatatactctgtaagtcca
tcaaaacctcctcaatatacaggtccaaacgctataattcaaaattcccttgtagtagaa
ggttgtgctgtctttggcaaaattcaaaactctgtactattcccagaagttgaagttgga
tcaaacagtataattcaagattccgtaataatgagtaacgtaaagattggacagaacgta
attattagaaaatgcataatcggaagtaacacaattatagaaaacaatagcgttattggg
aactccgatgacataacagttattggagatggagaaaaaataaagacaaactctataatt
aaaaattag

DBGET integrated database retrieval system