KEGG   Clostridium novyi: NT01CX_0791Help
Entry
NT01CX_0791       CDS       T00431                                 

Gene name
celM
Definition
aminopeptidase M42 family endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cno  Clostridium novyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT01CX_0791 (celM)
Enzymes [BR:cno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     NT01CX_0791 (celM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2481461..2482444)
Genome map
AA seq 327 aa AA seqDB search
MDKLIESLIDSFGVSTKENKLKSIIKEQINLIQENKKVNIDVLEDDMGNLIAKMGNGKEK
LMLCTHMDNTGLMATEIDDRGFVKVIPIGDVNLKNISGSFFKTEDGKVARIGFLKEDSSK
DNLFVDFGVSNKEAAKSKIAEGEALEILGQKIEVENKIIAPNIHSRIACYVLLKVMENMD
IYKVDKEILFVFSVQKELGFKGAKISAVNIKPNTAIVLDSMESGDNKGGDLKISLENGPV
LSVFDRSLVIHHKVKELIETSAEDLGIKLQYSIGMGQNEGGLIHKEVGGIKTGMIALPCR
YMNTSGEMMSLKDVQETIDLLGKIITK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggataaattaatagaaagtttaatagattcatttggggttagcactaaagaaaataaa
ttaaagagcataataaaagaacaaataaatttaatacaagaaaataaaaaggtaaatata
gatgtattagaagatgatatgggtaatttaattgctaaaatgggaaatggcaaggagaaa
cttatgctatgtactcatatggataatacaggacttatggcaactgaaatagatgataga
ggatttgttaaggtaattcctataggagatgtaaatttaaaaaatatttcaggaagcttt
tttaagactgaagatggaaaagttgcaagaataggatttttaaaggaagattcatctaaa
gataacttatttgtagactttggagtttcaaacaaagaagctgcaaaatcaaaaatagct
gaaggggaagcacttgaaattttaggacaaaagatagaggttgaaaataaaataatagca
cctaatattcatagtagaatagcatgttatgtacttcttaaagtaatggaaaacatggat
atttataaagtggataaggaaatcttatttgttttctctgttcaaaaggaattagggttt
aagggtgcaaaaatatcagctgttaatataaaaccaaatacagcaatagtattagattca
atggagtcaggtgataacaaaggtggagatttaaaaatatctctagaaaatggacctgtt
ttatctgtttttgatagaagtcttgtaattcatcataaggttaaagaacttatagaaact
tcagcagaagatttaggaataaagcttcaatatagtataggtatgggacaaaatgaaggt
ggacttatacataaagaagttggaggaataaaaactggaatgatagcattaccttgtaga
tatatgaatacttcaggtgagatgatgtcattaaaagatgtacaagagactattgatcta
ttaggaaaaatcataactaaataa

DBGET integrated database retrieval system