KEGG   Clostridium novyi: NT01CX_0791Help
Entry
NT01CX_0791       CDS       T00431                                 

Gene name
celM
Definition
(GenBank) endoglucanase, aminopeptidase M42 family (EC:3.2.1.4)
Organism
cno  Clostridium novyi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2481461..2482444)
Genome map
AA seq 327 aa AA seqDB search
MDKLIESLIDSFGVSTKENKLKSIIKEQINLIQENKKVNIDVLEDDMGNLIAKMGNGKEK
LMLCTHMDNTGLMATEIDDRGFVKVIPIGDVNLKNISGSFFKTEDGKVARIGFLKEDSSK
DNLFVDFGVSNKEAAKSKIAEGEALEILGQKIEVENKIIAPNIHSRIACYVLLKVMENMD
IYKVDKEILFVFSVQKELGFKGAKISAVNIKPNTAIVLDSMESGDNKGGDLKISLENGPV
LSVFDRSLVIHHKVKELIETSAEDLGIKLQYSIGMGQNEGGLIHKEVGGIKTGMIALPCR
YMNTSGEMMSLKDVQETIDLLGKIITK
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggataaattaatagaaagtttaatagattcatttggggttagcactaaagaaaataaa
ttaaagagcataataaaagaacaaataaatttaatacaagaaaataaaaaggtaaatata
gatgtattagaagatgatatgggtaatttaattgctaaaatgggaaatggcaaggagaaa
cttatgctatgtactcatatggataatacaggacttatggcaactgaaatagatgataga
ggatttgttaaggtaattcctataggagatgtaaatttaaaaaatatttcaggaagcttt
tttaagactgaagatggaaaagttgcaagaataggatttttaaaggaagattcatctaaa
gataacttatttgtagactttggagtttcaaacaaagaagctgcaaaatcaaaaatagct
gaaggggaagcacttgaaattttaggacaaaagatagaggttgaaaataaaataatagca
cctaatattcatagtagaatagcatgttatgtacttcttaaagtaatggaaaacatggat
atttataaagtggataaggaaatcttatttgttttctctgttcaaaaggaattagggttt
aagggtgcaaaaatatcagctgttaatataaaaccaaatacagcaatagtattagattca
atggagtcaggtgataacaaaggtggagatttaaaaatatctctagaaaatggacctgtt
ttatctgtttttgatagaagtcttgtaattcatcataaggttaaagaacttatagaaact
tcagcagaagatttaggaataaagcttcaatatagtataggtatgggacaaaatgaaggt
ggacttatacataaagaagttggaggaataaaaactggaatgatagcattaccttgtaga
tatatgaatacttcaggtgagatgatgtcattaaaagatgtacaagagactattgatcta
ttaggaaaaatcataactaaataa

DBGET integrated database retrieval system