KEGG   Clostridium novyi: NT01CX_0793Help
Entry
NT01CX_0793       CDS       T00431                                 

Definition
(GenBank) endoglucanase, aminopeptidase M42 family
Organism
cno  Clostridium novyi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2482748..2483716)
Genome map
AA seq 322 aa AA seqDB search
MLLEKLCNSVALPSYEDEVRDLIKNSIKDFVDEIKVDRMGNIVAHKKGNGKTVILDAYMD
EVGFIITAFNDDGTLKFTTLGSVDEKSIPCKDVIIGDKRINGVIGFKAIHLQGKKEREEN
IDIEKLSIDIGAKSKEQAKKYVSIGDYVSFTSKFSKLGNKLVKGKALDSRIPCYILIELL
KENYNADIYAIFSVQKQVGNRGAIVSSYNKKSDITIVFEGGLSKNNDNVIDKGPSLSRID
GNVVCNNDVINDIKTIGQKESIPYEIKNNKNKGNSGDSYVENGSKLVTVSVPCKYMNSAI
SVSSIDDIENTIKLIRGYLKSL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcttctagaaaaactttgtaattcagtggcacttccttcttatgaagatgaagttaga
gacttaataaagaattcaataaaagattttgttgacgaaataaaagttgatagaatgggc
aatatagtagctcataaaaaaggtaatggtaaaactgtaatactagatgcctacatggat
gaggttggatttattattactgcatttaatgatgatggaacattaaaattcacaacactt
ggaagtgtagatgaaaaatctattccatgtaaagatgttataataggtgataaaagaatt
aatggtgttataggatttaaggcaattcatcttcaaggaaaaaaagaaagagaagaaaat
attgatattgaaaaattatctatagatattggagcaaaatcaaaagaacaagctaaaaaa
tatgtatctataggagattacgtatcatttacaagtaagttttcaaagcttggaaataaa
cttgtaaaaggaaaggcacttgatagcagaattccatgttatatattaatagaactttta
aaggaaaattataatgctgatatatatgctatattctccgttcaaaagcaagttggaaat
agaggggctattgtatcttcatataataaaaaaagtgatattacaattgtttttgaaggt
ggattaagtaagaataatgataatgtaatagataaagggccttcattatcaagaatagat
ggtaatgttgtttgcaataatgatgttattaatgatataaagactattggacaaaaagaa
agcataccatatgaaataaaaaataataaaaataagggaaatagcggagattcttatgta
gaaaatggttcaaagcttgttacagtatcagttccatgtaaatacatgaattctgcaatt
tcagtttcttcaatagatgacattgaaaataccataaaattaattaggggatatttaaaa
tctttataa

DBGET integrated database retrieval system