KEGG   Clostridium novyi: NT01CX_0794Help
Entry
NT01CX_0794       CDS       T00431                                 

Definition
(GenBank) Peptidase family M20/M25/M40 protein
Organism
cno  Clostridium novyi
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2483707..2484726)
Genome map
AA seq 339 aa AA seqDB search
MDNKELLKKLTLAHAPSSREDKLYSLIKDNFSEFGKVTIDEMNNIIVHKKGTKKGSIMIM
AHADEIFLIVNDILENGTLKFKGVGVDPKAIVGREVTIHGKEDILGVINTSKDTDKAVTA
DDLAIETGYSKENIEKIVRIGDFVTINGKFVELLNNEIACKTIDNRGSIVSMYQCAKELQ
NIEHDLDVYFVCSCQEEVGHRGAKMVTYNLNPDIGIAIDTTFDSGALGTHDRENVIGNGP
VICHGPNLHHKLNKKIIEIGDKYKIPYGVEVEPGNTGTDAWDIQVTREGVPSMLVSIPIK
YMHTPVELVSMDDINNTGKIIAKLIENLKSDDLEELLCF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggataataaagaactattaaaaaaactaactttagctcatgctccaagtagtagagag
gataagttatattcattaataaaagataattttagtgaatttggcaaagttacaatagat
gaaatgaacaatattatagttcataaaaaaggcactaaaaaaggtagcataatgataatg
gctcatgcagacgaaatctttctaattgtaaatgacatattagaaaatggtactttaaaa
tttaaaggtgttggagttgatcccaaggcaatagtaggtagagaagttacaatacacgga
aaagaagatatacttggagttataaatacaagtaaagatacggataaggcagttacagca
gatgatttagctattgaaacagggtattcaaaagagaatatagaaaaaatagttcgtata
ggagactttgtaactataaatggaaagtttgtagagcttttaaacaatgaaattgcctgc
aagactatagataatagaggaagcattgtttctatgtatcagtgtgcaaaggaacttcaa
aatatagaacatgatttagatgtttattttgtatgctcatgtcaagaggaggttggacat
agaggggccaaaatggtaacttataatttaaatcctgacattggaatagcaatagataca
acctttgatagtggtgcccttggtactcatgatagagaaaatgtaataggcaatggacct
gtaatatgtcatggaccaaatcttcatcataagttaaataaaaaaattatagaaataggc
gacaaatataaaataccttatggagtagaagttgagccaggaaatacaggaacagatgca
tgggatatacaagttacaagagaaggagtacccagtatgcttgtatcaattccaataaaa
tatatgcatactccagtggaacttgtaagtatggatgatataaataatactggaaagatt
attgcaaaattaatagaaaacttaaaaagtgatgatttggaggaattattatgcttctag

DBGET integrated database retrieval system