KEGG   Clostridium novyi: NT01CX_0897Help
Entry
NT01CX_0897       CDS       T00431                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cno  Clostridium novyi
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01CX_0897
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01CX_0897
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NT01CX_0897
Enzymes [BR:cno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NT01CX_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
24391..25881
Genome map
AA seq 496 aa AA seqDB search
MEKIFYRSTRGREDNISSSQAILKGIADDGGLFVPNRIPKIDKSLQELSKMNYRELAYFV
MSKFFTDFTEEELRICIDRAYDNKFDTENIAEIKKVGNDFFLELYHGPTLAFKDMALSIL
PHLLTTSAKKQNLNKEIVILTATSGDTGKAALEGFTNVDGTKIIVFFPEEGVSEIQKKQM
VTHKGNNTYVVGIEGNFDDAQSGVKKIFRDENFIELLDKNNYVFSSANSINIGRLIPQVV
YYFYGYLKMCNMKEVTLGESINVTVPTGNFGNILAAYYAKTMGLPINKLICASNDNKVLY
EFLSTGRYDKLREFVTTISPSMDILISSNLERLLYSISGENQDLVRSLMSNLESKGSYEI
TSDMKERIKDFYGNFASEDETRKGIKEVYRSSKYLIDTHTSVAYGVNKKYKEEFNDNKKT
LIASTASPYKFTYAVMNALDDSFKNYNDFKLIKEMNKFVGAEEPKAIKDIEKREVLHNAV
CNKDNMKEEIKRILNI
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagattttttatagaagtacaagagggagagaagataacatatcatcatcacaa
gctatattaaagggaatagcagatgatggaggattatttgtaccaaacagaattcctaaa
atagataaatcactacaggaattaagtaaaatgaattatagagaacttgcatattttgtt
atgagcaaattctttactgattttactgaagaggaactaaggatatgtatagacagggcg
tatgataacaagtttgatacagaaaatatagctgaaataaaaaaagtaggtaatgatttc
tttttagaactttatcatggaccaactcttgcatttaaggatatggctttatcaatactt
cctcatcttttaactacatctgctaaaaaacaaaacctaaacaaagaaatagtaatttta
actgcaacatcaggggatactggtaaggcagcacttgaaggctttacaaatgttgatgga
acaaaaattatagtattcttcccagaagaaggggtaagtgaaattcaaaagaaacaaatg
gttactcataaaggaaacaatacttatgtagttggaatagaaggaaattttgatgatgct
caaagtggagttaaaaagatttttagagatgagaactttatagagctgttagataaaaac
aattatgtgttttcttctgcaaactcaatcaatataggtcgtctaattcctcaagttgta
tattacttctatggatatttaaaaatgtgtaatatgaaagaagtaactttaggagaaagc
ataaatgtaactgttcctacaggaaactttggaaacatacttgcagcatattatgcaaaa
acaatgggtcttccaattaataagcttatatgtgcatctaatgataacaaagtactatat
gaatttttaagcacaggaaggtacgataagctaagagaattcgtaacaacaatatcacct
tctatggatatattaatttcaagtaaccttgaaagacttttatatagcataagtggagaa
aatcaagatttggtaaggtcgcttatgagtaatctagaaagtaaaggaagctatgaaata
acaagtgatatgaaggaaagaattaaagatttctacggaaattttgcatcagaagatgaa
acaagaaaaggaataaaggaagtttatcgaagtagtaaatatttaattgatactcataca
tctgttgcatatggtgttaataaaaagtataaagaagaatttaatgataataaaaagact
ttaatagcatcaacagctagtccatataaattcacttatgcagttatgaatgctttagat
gatagctttaagaattacaatgattttaaacttataaaggaaatgaataaatttgtagga
gctgaagaaccaaaagcaataaaggatatagaaaaaagagaagttcttcataatgcagta
tgcaataaagataatatgaaagaagaaataaaaagaattttaaatatataa

DBGET integrated database retrieval system