KEGG   Clostridium novyi: NT01CX_0902Help
Entry
NT01CX_0902       CDS       T00431                                 

Gene name
proB
Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cno  Clostridium novyi
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cno01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cno00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(29030..30169)
Genome map
AA seq 379 aa AA seqDB search
MNNLRETYIKDVKRIVVKVGTSTLTYPTGLLNLNKIENLVRQLSDAQNRGIEVILVSSGA
IGAGIGKLGLKERPKTIPEKQAAAAVGQGILLHMYEKIFSEYGKPVGQILLTREDLSHRT
RFLNASNTFYSLLEQGVIPIVNENDAIVVDEIKFGDNDTLSAMVASLVDADLLILVTDID
GLYDSNPKTNPDAKFIPVVDEITEDIVAAAGGAGSSLGTGGMATKINAGKIATSSGSSMV
IVNGDNRNFLTDILDGKEIGTLFLGQEDHVKAKKHWMAFATKPTGSIIVDDGAEKALVNH
NKSLLPKGIISIDGTFQEGEVVSILNSKKEEIAHGITNYNSMEIDLIKGLDSNIIEDKLG
YKNYDEVIHKNNLVILENL
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacaatttaagagaaacctacataaaagacgtaaaaagaatcgtagtaaaggtcggt
acatcaacattaacttatcccacaggactacttaacttaaataaaatagaaaacctagtt
agacagctttccgatgcccaaaatcgtggaattgaagttattcttgtatcatctggtgca
ataggagcaggtattggaaaacttggacttaaagagagacctaaaactattcctgaaaaa
caagcagctgctgctgtaggtcaaggtatacttttacatatgtatgaaaagattttttca
gaatacggaaaaccagtaggacaaatacttttaactcgcgaggacttatctcatagaact
agatttttaaatgctagtaacactttctactcactacttgaacaaggcgtaattcctatt
gtaaatgaaaatgacgctatagtagtagatgaaattaaatttggtgataacgacactcta
tcagctatggtagcaagtcttgttgacgctgatttattgattttagttacagatatagat
ggactatatgattcaaatccaaaaacaaatcctgatgctaaatttattcctgtagttgat
gagattacagaggatattgtagctgctgcaggtggtgctggaagttcacttggtactggt
ggaatggcaactaaaataaatgcaggtaaaatcgcaacatcatcaggttcatcaatggtt
atcgtaaatggagacaatcgtaatttcctaacagacatccttgatggaaaagaaataggt
acattattcctaggacaagaggatcatgttaaagcaaaaaaacattggatggcttttgca
actaagccaacgggttctataatagtagatgatggtgcagaaaaagcactagtaaaccat
aataaaagcttacttccaaagggtataatatctattgatggtacttttcaagaaggagaa
gttgtgtcaattttaaattctaaaaaagaagaaatagcacatggaattacaaattataac
tctatggaaattgatttaataaagggattagattctaatataatagaagataaactaggt
tataaaaactatgatgaagtaattcacaaaaacaacttagtaatattagaaaacctataa

DBGET integrated database retrieval system