KEGG   Clostridium novyi: NT01CX_0969Help
Entry
NT01CX_0969       CDS       T00431                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cno  Clostridium novyi
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    NT01CX_0969 (malQ)
Enzymes [BR:cno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     NT01CX_0969 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
91138..92616
Genome map
AA seq 492 aa AA seqDB search
MFERSSGILMHITSLPSPYGIGTLGKEAYRFVDFLVKAGQKYWQVLPLGPTGYGDSPYQS
FSAFAGNPYLIDLDLLCKEGLLEVNDYKYINFGYNCEEVDFQKIAENKMPILKMAFKNLK
DKYRDELQQFKEENDEWIEDYALYMALKVKNNLKSWQLWDKDIKLRKKDALNKAKKELKD
DIDYNIFLQFMFYKQWNNLKEYANKNGIKIIGDIPIYVAEDSADTWASSELFLLDKDKRP
IVVSGCPPDGFSETGQLWGNPIYNWKYLEETNYSWWVKRIKANSKLYDVTRIDHFRGFES
YWQVPYGEETAINGEWVKGPAMKLFNVIKKELGDVDIIAEDLGYLTDEVRKFREDSGYPG
MKVLEFAFDAREESDYLPHNYDKDCVVYTGTHDNDTVNGWFENANKSDVDFAIKYLKLTK
EEGYNWGFIRGALSSVASLAIAQFQDYLGLGTEARMNIPSTLGGNWRWRAKKKDINGDLS
KKICEITKLYGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagagaagcagtggaattttaatgcatattacttctttgcctagtccctatgga
atagggactttaggaaaagaagcctatagatttgtagacttcttagttaaagcgggacaa
aaatattggcaagttttgcccttaggacctactggatatggagattctccctatcaatca
ttttcagcttttgcaggaaatccatatcttatagatttagatttgctatgcaaagaagga
ctattagaagttaatgattataaatatataaattttgggtataactgtgaagaagtagac
tttcaaaaaatagcagaaaataaaatgcctatattaaaaatggcttttaaaaatttaaaa
gataaatatagagatgagttacaacaatttaaagaagaaaatgatgaatggatagaagac
tatgctttatatatggcgttaaaagtaaaaaataatttaaagtcgtggcaactatgggac
aaggatataaaacttagaaaaaaggatgccttaaataaggcgaaaaaagagcttaaagat
gatatagattataatatatttttacagtttatgttttataagcagtggaacaatttgaaa
gaatatgctaataaaaatggaatcaagataattggagacataccaatttatgttgcagaa
gatagtgcagatacatgggcaagtagtgaactatttttattagataaagataaaagacca
atagttgtatccggctgtcccccagacggattttctgaaactggacagctttggggaaat
ccaatatataattggaagtatttagaggagacaaattacagttggtgggtaaaaagaata
aaagctaatagtaaactttatgatgtaactagaatagatcattttagagggtttgaatca
tattggcaagttccttacggagaagaaaccgctataaatggtgaatgggtcaaaggtcct
gctatgaaattatttaatgttataaaaaaagaactgggtgatgtagatataatagctgaa
gacttaggatatttaacagatgaggttaggaaatttagagaagatagtggatatcctggt
atgaaggtattagagtttgcttttgatgctagagaggaaagtgattatcttccacataat
tatgataaagattgtgtagtttatacaggtacacatgataatgatactgtaaatggatgg
tttgaaaacgctaataaaagtgatgtggattttgctataaaatatttaaaacttactaag
gaagaaggatataactggggatttataagaggagctttaagttcagtagcttcccttgct
attgcacaatttcaagattatttaggacttggaacagaagcaagaatgaatattccatca
acattaggtggcaattggagatggagagctaaaaagaaagatataaacggagatttgagc
aagaaaatatgtgaaattaccaaactgtatggaaggtag

DBGET integrated database retrieval system