KEGG   Clostridium novyi: NT01CX_1079Help
Entry
NT01CX_1079       CDS       T00431                                 

Definition
(GenBank) Xaa-His dipeptidase, putative
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cno  Clostridium novyi
Pathway
cno00300  Lysine biosynthesis
cno01100  Metabolic pathways
cno01120  Microbial metabolism in diverse environments
cno01230  Biosynthesis of amino acids
Module
cno_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NT01CX_1079
Enzymes [BR:cno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NT01CX_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 ERK-JNK_inhib
Motif
Other DBs
NCBI-ProteinID: ABK61717
UniProt: A0PXR1
Position
197170..198555
Genome map
AA seq 461 aa AA seqDB search
MKINNLVDNMKESIVKSTQELILIKSVKEEPKENKPFGEGPAKALEYCLNLCDKLGFKTV
NLDNYIGYAEYGEGEDYIGVLGHVDVVPEGDGWIYPPYAAEVHDGKIFGRGTMDDKGPMI
ACVYGLKAIKDAGIKPSKKIRIIFGTNEESGSEGEIDRYFESEKAPIAGFTPDAEYPIIN
GEKGLTIFDLVKELDSKNSSIAYIKGGQKANMVPDYCEAGILINDANLVISAAKEFVDKT
GFDISVEPKDDMVVVKSKGVAAHGSLPQLGKNAIMQLFMFIGELPLEKSDIVNFIKFMNK
HIGMEVYGESFGVGLEDEVSGKLSFNVGVVNMNKDKVTMTLNLRYPVTCKFEDMINGLNK
TLSNTDIKIENMDHQEPLYFPEDNPIIKVLSKVYEEQTGDKTKLLSIGGGTYAKEMPNIV
AFGPIFPGEPDLDHQANEYMKIDDLIKNTKIYAHAMYELAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaataatttagtagataacatgaaagaaagcattgtaaagtctactcaagag
ttaatattaataaaaagtgttaaagaagaaccaaaggaaaataagccttttggagaagga
ccagcaaaagctcttgaatattgcttaaatttatgtgataagctagggtttaaaacagtt
aacttagataattacataggttatgcagaatacggtgagggagaagattacataggagtt
ttaggtcatgttgatgtagttccagaaggggatggctggatttatccaccttatgcagca
gaagtacatgatggcaaaatatttggtcgtggtactatggatgataaaggacctatgatt
gcttgtgtatatggtcttaaggctattaaagatgctggaattaaaccttctaaaaaaata
agaattatttttggaactaacgaagaaagtggttcagaaggagaaatagatcgttatttc
gaaagtgaaaaagcacctattgctggatttactcctgatgctgaatatccaattataaat
ggagaaaagggacttacaatatttgatttagtaaaagaattagacagtaaaaatagttct
atagcttatataaagggtggtcaaaaggcaaatatggttcctgactactgtgaagctgga
attttaattaatgatgctaatttagttataagtgcagcaaaagagtttgttgataaaaca
ggatttgatatatcagtagaaccaaaggatgatatggtagttgttaaatcaaagggtgtt
gcagcacatggaagccttccacaactaggtaaaaacgccataatgcaattattcatgttt
ataggagaattaccacttgaaaagagtgatatagttaactttattaaatttatgaataag
cacattggtatggaagtttacggagaatcttttggtgttggacttgaagatgaagtatca
ggaaaactttcatttaatgttggtgtagtaaatatgaataaagataaggtaactatgaca
ttaaatttaagataccctgtaacatgtaaatttgaagatatgataaatggtttaaataaa
acattatctaacacagatataaagatagaaaatatggatcatcaagaacctttatatttt
ccagaggataatccgattataaaagtactttcaaaggtttatgaagaacaaacaggagat
aaaacaaaattactatcaattggtggaggaacatatgcaaaggagatgcctaatatagtt
gcctttggcccaatattcccaggtgaacctgacttagatcatcaagctaacgagtatatg
aaaattgatgatttaattaaaaacactaaaatttatgctcatgctatgtatgaacttgca
aaataa

DBGET integrated database retrieval system