KEGG   Clostridium novyi: NT01CX_1079Help
Entry
NT01CX_1079       CDS       T00431                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cno  Clostridium novyi
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01CX_1079
  Amino acid metabolism
   00300 Lysine biosynthesis
    NT01CX_1079
Enzymes [BR:cno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NT01CX_1079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197170..198555
Genome map
AA seq 461 aa AA seqDB search
MKINNLVDNMKESIVKSTQELILIKSVKEEPKENKPFGEGPAKALEYCLNLCDKLGFKTV
NLDNYIGYAEYGEGEDYIGVLGHVDVVPEGDGWIYPPYAAEVHDGKIFGRGTMDDKGPMI
ACVYGLKAIKDAGIKPSKKIRIIFGTNEESGSEGEIDRYFESEKAPIAGFTPDAEYPIIN
GEKGLTIFDLVKELDSKNSSIAYIKGGQKANMVPDYCEAGILINDANLVISAAKEFVDKT
GFDISVEPKDDMVVVKSKGVAAHGSLPQLGKNAIMQLFMFIGELPLEKSDIVNFIKFMNK
HIGMEVYGESFGVGLEDEVSGKLSFNVGVVNMNKDKVTMTLNLRYPVTCKFEDMINGLNK
TLSNTDIKIENMDHQEPLYFPEDNPIIKVLSKVYEEQTGDKTKLLSIGGGTYAKEMPNIV
AFGPIFPGEPDLDHQANEYMKIDDLIKNTKIYAHAMYELAK
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaataatttagtagataacatgaaagaaagcattgtaaagtctactcaagag
ttaatattaataaaaagtgttaaagaagaaccaaaggaaaataagccttttggagaagga
ccagcaaaagctcttgaatattgcttaaatttatgtgataagctagggtttaaaacagtt
aacttagataattacataggttatgcagaatacggtgagggagaagattacataggagtt
ttaggtcatgttgatgtagttccagaaggggatggctggatttatccaccttatgcagca
gaagtacatgatggcaaaatatttggtcgtggtactatggatgataaaggacctatgatt
gcttgtgtatatggtcttaaggctattaaagatgctggaattaaaccttctaaaaaaata
agaattatttttggaactaacgaagaaagtggttcagaaggagaaatagatcgttatttc
gaaagtgaaaaagcacctattgctggatttactcctgatgctgaatatccaattataaat
ggagaaaagggacttacaatatttgatttagtaaaagaattagacagtaaaaatagttct
atagcttatataaagggtggtcaaaaggcaaatatggttcctgactactgtgaagctgga
attttaattaatgatgctaatttagttataagtgcagcaaaagagtttgttgataaaaca
ggatttgatatatcagtagaaccaaaggatgatatggtagttgttaaatcaaagggtgtt
gcagcacatggaagccttccacaactaggtaaaaacgccataatgcaattattcatgttt
ataggagaattaccacttgaaaagagtgatatagttaactttattaaatttatgaataag
cacattggtatggaagtttacggagaatcttttggtgttggacttgaagatgaagtatca
ggaaaactttcatttaatgttggtgtagtaaatatgaataaagataaggtaactatgaca
ttaaatttaagataccctgtaacatgtaaatttgaagatatgataaatggtttaaataaa
acattatctaacacagatataaagatagaaaatatggatcatcaagaacctttatatttt
ccagaggataatccgattataaaagtactttcaaaggtttatgaagaacaaacaggagat
aaaacaaaattactatcaattggtggaggaacatatgcaaaggagatgcctaatatagtt
gcctttggcccaatattcccaggtgaacctgacttagatcatcaagctaacgagtatatg
aaaattgatgatttaattaaaaacactaaaatttatgctcatgctatgtatgaacttgca
aaataa

DBGET integrated database retrieval system