KEGG   Clostridium novyi: NT01CX_1297Help
Entry
NT01CX_1297       CDS       T00431                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cno  Clostridium novyi
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01CX_1297
   01230 Biosynthesis of amino acids
    NT01CX_1297
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_1297
   00030 Pentose phosphate pathway
    NT01CX_1297
   00051 Fructose and mannose metabolism
    NT01CX_1297
   00052 Galactose metabolism
    NT01CX_1297
  Energy metabolism
   00680 Methane metabolism
    NT01CX_1297
Enzymes [BR:cno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     NT01CX_1297
Protein phosphatases and associated proteins [BR:cno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     NT01CX_1297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
425904..426863
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTGLDKGLKVMGIQRGYSGLINGEIFEMHRYSVADI
IHRGGTILRTARCEEFKTEAGRKKGVNILKAFGIDGVVVIGGDGSFQGAQLLSKLGVKTI
GIPGTIDNDLAYTDYTIGFDTATNTVLDAINKLRDTSSSHERVSIVEVMGRGCGDLALFA
GIGGGAESVIVPEKEFNEDELCKTILEGKLRGKLHNLIILAEGVGGGEALTKKVQETTGI
QTRLTTLGHLQRGGSPSAFDRILASRLGVKAVELLLEGKSSRVVGLRNNKVVDDDIDEAL
SMKSKFDDELYDIAKILSY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgccgttttaacaagtggtggagatgcacctggaatgaatgctgcaatt
agagcagttgtaagaacaggattagacaagggtctaaaagtaatgggaatacaaagagga
tacagtggtttaataaacggagaaatttttgaaatgcaccgctacagtgttgccgatata
atacatagaggcgggacaattttaagaacagctcgttgtgaagaatttaagacagaagct
ggaagaaaaaaaggtgttaatattttaaaagcttttggtattgatggagttgttgtaata
ggtggagatggatctttccaaggagcacaattgctatcaaaattaggagttaaaacaata
ggaataccaggtactatagataatgacctagcatatacagattatactattggttttgac
actgccactaacacagttttagatgctatcaataaattaagagatacttcatcttctcat
gaaagagttagtatagttgaagttatgggaagaggatgcggtgacttagcactattcgca
ggaataggtggaggagctgaaagcgtaatcgttccagaaaaagaattcaatgaagatgaa
ttatgtaaaacaatattagaaggtaagttaagaggaaaacttcacaaccttatcatctta
gcagaaggtgtaggtggaggagaagctctaactaaaaaagttcaagaaacaacaggaata
caaactagattaacaactttaggacatttacaaagaggaggaagcccttctgcatttgat
agaattctagcttctagattaggagttaaagctgttgaattattactagaaggaaaatct
tcaagagtagttggtttacgtaataataaggtagttgatgatgatatagatgaagcgtta
tcaatgaaaagcaaatttgatgatgaactatatgatatagcaaaaatactatcttattaa

DBGET integrated database retrieval system