KEGG   Clostridium novyi: NT01CX_1342Help
Entry
NT01CX_1342       CDS       T00431                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cno  Clostridium novyi
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NT01CX_1342 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NT01CX_1342 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NT01CX_1342 (trpB)
Enzymes [BR:cno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NT01CX_1342 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
481326..482495
Genome map
AA seq 389 aa AA seqDB search
MKKQFGKFGGQYVSKELTSTLKNLEENFFKYCNDDDFKKEYIYYLNNYIGRPSLLYYAKR
LTKSLGGAKIYLKREDLNHTGAHKINNAIGQILLAKRMGKKKVIAETGAGQHGVATATAA
ALFGMECTIFMGEEDIKRQKLNTFKMELLGAKIKPVKSGNGTLKDAVDEAIKQWVKSSDD
TFYVLGSAVGPHPYPTMVREFQKIIGEETKDQILRMEGRLPDTLIACVGGGSNAIGLFYP
FIKDENIEIIGVEAGGKGVETGEHGAAFADGRVGVIHGMKTVIMEDDNGNVKEAYSISAG
LDYPGVGPEHAYLNDIGRAKYVSITDEEAVEAFKYLCANEGIIPALESSHAIAYTMKLAP
NMDKDKIIVVNLSGRGDKDVETISEYLNK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacagtttggaaaatttggaggacaatatgtatcaaaagaattaactagcaca
ttaaagaatttggaggaaaatttttttaagtattgtaatgatgatgattttaaaaaagaa
tatatatattatttaaataattatataggaagaccatcgttactttattatgcaaaaaga
cttacaaaatctttagggggggcaaagatatatttaaagagagaagatttgaatcacaca
ggtgctcataagataaacaatgctattggtcaaatacttttggcaaaacgtatgggaaag
aaaaaagtaattgcagaaacaggggcaggacaacatggtgttgctacagctacagcagct
gcactattcggaatggaatgtactatattcatgggagaagaagatataaaaagacaaaaa
ttgaatacttttaaaatggagttattaggggcaaagattaagcctgtaaaatcaggaaat
ggaactttaaaagatgcagtagatgaggcaataaaacagtgggtgaaaagttctgatgat
actttttatgtattaggttcggcagtaggaccacacccatatccaactatggtaagagaa
tttcaaaagataattggagaagaaacaaaagatcagatattgaggatggaaggaagactc
ccagatactttaattgcgtgtgttggaggaggaagtaatgcaataggattattttatcct
tttattaaagatgagaatattgaaataataggagttgaagctggaggaaaaggtgtagaa
acaggagaacatggggcagcatttgctgatggaagagttggagtaattcatggaatgaag
acagttattatggaagatgataatggcaatgtaaaagaagcatattctatttcagcagga
cttgattatccaggagttggacctgagcatgcatatttaaatgatattggaagagcaaag
tatgtatctataacagatgaagaagcagttgaagcttttaagtatttatgtgctaatgaa
ggaataattccagcattagaaagttcacatgcaatagcttatactatgaaacttgctcct
aatatggataaagataaaattatagttgttaatttatccggtagaggagataaggatgtt
gaaactataagtgagtatttaaataaataa

DBGET integrated database retrieval system