KEGG   Clostridium novyi: NT01CX_1412Help
Entry
NT01CX_1412       CDS       T00431                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cno  Clostridium novyi
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01CX_1412 (tpiA)
   01230 Biosynthesis of amino acids
    NT01CX_1412 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_1412 (tpiA)
   00051 Fructose and mannose metabolism
    NT01CX_1412 (tpiA)
   00562 Inositol phosphate metabolism
    NT01CX_1412 (tpiA)
Enzymes [BR:cno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NT01CX_1412 (tpiA)
Exosome [BR:cno04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NT01CX_1412 (tpiA)
  Exosomal proteins of bladder cancer cells
   NT01CX_1412 (tpiA)
  Exosomal proteins of melanoma cells
   NT01CX_1412 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
565115..565867
Genome map
AA seq 250 aa AA seqDB search
MRKAIIAGNWKMNNTISQGLKLVEELKPLVADANCDVVVCPPTLALDAVVKATEGTNIKV
GAQNMHFEESGAFTGETAPAMLEELGVKYVILGHSERRQYFGENDADLNKKMKKAFEHNL
TPILCIGETLEEREADVTEEVLAKQIKLDLAGLTEAQIAETVIAYEPIWAIGTGKTATSD
QAEETIAFVRKTVAGMFGAEAAEKMRIQYGGSVKPATIKEQMAKPNIDGGLIGGASLKAA
DFAAIVNFDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattatagctggaaactggaaaatgaacaacacaatttcacaaggatta
aaacttgttgaagaattaaaaccattagtagcagatgcaaactgtgacgtagtagtttgt
ccaccaacattagctttagatgctgtagtaaaagctactgaaggaactaacataaaagtt
ggagcacaaaacatgcactttgaagaaagtggagcatttactggggaaacagcaccagct
atgcttgaagaactaggagtaaaatacgttatattaggacatagtgaaagaagacaatac
ttcggagaaaatgatgctgacttaaacaaaaaaatgaagaaagcatttgaacataaccta
actccaatcctttgcataggagaaactttagaagaaagagaagcagatgtaactgaagaa
gtacttgcaaaacaaatcaaacttgatttagcaggacttactgaagctcaaatagcagaa
actgtaatagcttatgaaccaatctgggctatcggaacaggaaaaactgctacatctgat
caagcagaagaaactatagctttcgtaagaaagacagttgcaggaatgtttggagcagaa
gctgctgaaaaaatgagaattcaatacggtggatcagttaaaccagcaacaataaaagaa
caaatggcaaaaccaaacatagacggtggtcttataggtggagcttctcttaaagctgct
gatttcgctgcaatagtaaatttcgataaataa

DBGET integrated database retrieval system