KEGG   Clostridium novyi: NT01CX_1512Help
Entry
NT01CX_1512       CDS       T00431                                 

Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cno  Clostridium novyi
Pathway
cno00010  Glycolysis / Gluconeogenesis
cno00030  Pentose phosphate pathway
cno00051  Fructose and mannose metabolism
cno00680  Methane metabolism
cno01100  Metabolic pathways
cno01110  Biosynthesis of secondary metabolites
cno01120  Microbial metabolism in diverse environments
cno01130  Biosynthesis of antibiotics
cno01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_1512
   00030 Pentose phosphate pathway
    NT01CX_1512
   00051 Fructose and mannose metabolism
    NT01CX_1512
  Energy metabolism
   00680 Methane metabolism
    NT01CX_1512
Enzymes [BR:cno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     NT01CX_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: ABK61346
UniProt: A0PYZ1
Position
complement(688456..690453)
Genome map
AA seq 665 aa AA seqDB search
MTFCDENNLDLIKKDLRYLKLLANQYPNISSASTEIVNLEAILNLPKSTEHFLSDIHGEY
ESFTHVLKNASGVIKRKIDDVFGNSLRDNEKLTLATVIYYPEQKLELIKQSEKDLSDWYK
ITLYRLIELCRVVSSKYTRSKVRKALPHDFAYIIEELLHEHDGTINKHEYYNGIVSTIID
IDRAPEFITAISKVIQRLVVDRLHIIGDIYDRGPGAEIIMEELMKHHSVDIQWGNHDILW
MGAAAGSEACICNVLRISLRYANLNTIEDGYGINLLPLATFAMDVYENDPCNSFIPKTIN
KELTQNELNLISKMHKAIAIIQFKLQGQIIKNHPEFKMDDQLLLDKINYEKGTIDLDGHI
YKLNDTFFPTVDPKDPYKLTENEDDLIKKLTRSFVNSEKLQRHIRFMYSKGSMYLVYNSN
LLYHGCVPLNEDGTFKEITIDGVRYSGKSLLDKFDSLAREAFFFKNGSSAKRFALDMMWY
LWCGPNSPEFGKLRMTTLERYFIDDKGTHIEYRNPYYKYRSNEKVVTNILKEFGLDPDCS
HVINGHIPVKTKAGENPIKANGKLLVIDGGFCRAYQPETGIAGYTLIYNSYGLLLSSHEP
FSSIRKAIEEEKDILSSTIILEQVVSRKRVADTDIGKELKKQIAELKMLLIAYRKGLIKE
QDSKS
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaccttctgtgacgaaaacaatttagatttaatcaaaaaagacttaagatatttaaaa
ttactagctaatcaatatccaaatatctcttctgcaagtaccgaaatagtaaatttagag
gctatattaaatttacctaaaagtacagaacactttttaagtgatattcatggagagtat
gaatcctttactcacgtattaaaaaacgcctctggtgttattaaacgtaaaatagatgat
gtttttggaaattctcttagggataatgaaaaattaactttggccacggttatttattat
cctgagcaaaagttagaacttattaagcaatctgaaaaggatttaagtgattggtacaaa
ataactttatacagacttattgagctttgtagagtagtatcttctaagtatactcgctct
aaagttagaaaagctttacctcatgattttgcttatataatagaagaattacttcacgaa
catgatggaactataaataaacatgagtattataatggtatagtttctactattattgat
attgatagagcgcctgagtttataactgctatttcaaaggttattcaaagattggtagtt
gatagacttcatattataggggatatttatgatagaggtcctggtgcggaaattataatg
gaagaattaatgaagcaccattcagttgatatacaatggggaaatcacgatattttgtgg
atgggtgctgctgctggttctgaagcttgtatatgtaatgttcttagaatctctctaaga
tacgctaatttaaatacaattgaagacggttacggtataaatttacttcctctagctacc
tttgccatggatgtttacgaaaacgatccttgcaatagttttattcctaagactattaat
aaggaacttactcaaaatgaacttaatttaatatccaaaatgcacaaggcaattgctata
attcaatttaaacttcaaggacaaataataaaaaatcatcctgagtttaaaatggacgac
cagttgctattagataaaattaattatgaaaaaggtacaatagatcttgatggacacatt
tacaaattaaatgatactttttttcctactgtagatccaaaagatccatataagcttaca
gaaaatgaagacgatttaataaagaagcttactcgttcttttgtaaatagtgaaaagctt
caaagacatatccgttttatgtatagtaaaggatctatgtatctagtttataattcaaat
ttattgtatcatggatgtgtgcctcttaatgaagatggtacatttaaagaaataacaatt
gacggagtacgctatagtggaaaatctcttttagataagtttgactcacttgcaagagaa
gcatttttctttaaaaatggttcttccgctaaaagatttgcacttgatatgatgtggtat
ttatggtgcggtcctaattcacctgaatttggtaaattaagaatgactactcttgaaaga
tactttatagatgacaagggtactcatattgaatatagaaatccttattacaagtataga
tcaaatgaaaaagtcgttacaaatattttaaaggaatttggacttgaccctgattgttct
catgtaataaatggacatattcctgttaaaactaaagctggtgaaaatcctattaaagct
aatggaaaacttttggttatagatggtggtttttgtagggcatatcaacctgaaacaggt
attgcaggatatactttaatatataattcctatggacttcttttaagttctcatgaacct
ttttcttctattagaaaggccattgaggaagaaaaagatattttatcttcaacaattatt
cttgaacaagttgtatcgagaaaaagagttgctgatacagatataggaaaagaattaaag
aaacaaatagctgaacttaaaatgttattaattgcatatagaaaaggtcttattaaagaa
caagacagcaaaagctaa

DBGET integrated database retrieval system