KEGG   Clostridium novyi: NT01CX_1778Help
Entry
NT01CX_1778       CDS       T00431                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cno  Clostridium novyi
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NT01CX_1778 (galU)
   00052 Galactose metabolism
    NT01CX_1778 (galU)
   00500 Starch and sucrose metabolism
    NT01CX_1778 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NT01CX_1778 (galU)
Enzymes [BR:cno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NT01CX_1778 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
983804..984718
Genome map
AA seq 304 aa AA seqDB search
MCGMRVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVQSGIEEILIITG
RNKRAIEDHFDKSVELENILEEKGKNDLLSMVKDISNMVDIYYIRQKEPKGLGHAINCAK
TFVGNEPFAVMLGDDVVDSKVPCLKQLIDCFNEYKTTILGVQEVNKNSVDKYGIVEGLHI
EDRVYKVKDLVEKPSVNEAPSNVAILGRYIITPPIFDILSHTKPGKSGEIQLTDALRTLI
KKEAMYAYKFEGRRYDVGDKLGFLEATVEFALKREGLKNEFMKYLTSIKYNSKFAQLYKE
MNQK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggtatgagggtaaaaaaagccataatacctgcagctggacttggaactagattt
cttccggctactaaagcgcaacctaaggagatgcttcccattgtagataagccaactata
cagtatattattgaagaagcggtacagtcaggtattgaagaaatattaataataacaggt
agaaacaaaagagcaattgaagatcattttgataagtcggtggaactggaaaacatattg
gaagaaaaaggtaaaaatgatcttttaagtatggttaaagatatatctaatatggtagat
atatactatatacgtcaaaaagagccaaagggacttgggcatgcaataaattgtgctaaa
acttttgttggcaatgaaccttttgctgttatgctaggagatgatgttgtagatagcaaa
gtaccttgtttaaaacaactaattgattgctttaatgaatataaaaccacaatacttgga
gtgcaagaagtaaataaaaacagtgtagataagtatggaatagtagaaggactacacata
gaagacagggtttataaggtaaaagatttagtagaaaaacctagtgtgaatgaagcacct
tctaatgtagcgattttaggaagatacataataactcctcctatttttgatatattaagt
catacaaagcctggtaagtcaggtgaaatacaattaacagatgctcttagaaccttaata
aaaaaagaagcaatgtatgcctacaaatttgaaggtagaagatatgatgtaggcgataaa
ttaggatttttagaggcaacagtagaatttgcactaaaaagagaagggttaaaaaatgaa
tttatgaaatatttaactagtattaagtataattcaaaatttgcacaattatataaagaa
atgaaccaaaaataa

DBGET integrated database retrieval system