KEGG   Clostridium novyi: NT01CX_1862Help
Entry
NT01CX_1862       CDS       T00431                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cno  Clostridium novyi
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:cno00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    NT01CX_1862
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    NT01CX_1862
Enzymes [BR:cno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     NT01CX_1862
Two-component system [BR:cno02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   NT01CX_1862
Bacterial motility proteins [BR:cno02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    NT01CX_1862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1074033..1075094
Genome map
AA seq 353 aa AA seqDB search
MEKIKVIVVDDSALMRKIISDMINMQPDMEVICTARNGEDLIKKLETEKPDVITLDIEMP
KMNGMETLHEMKIKKYKIPTIMLSSVSKEGTKLTMECLHNGAFDFIAKPSGAISLDIEKV
GDELVSKIRVSKSKNNFKIKRNIDKSALSKTKIRRMPSKVGTSNIEAVVIGASTGGPKAL
YKVITELPEKLGVPIFVVQHMPVGFTKAFADRLDANSKIKVIEASEGDIIKKDVVYVAKG
GSHMEITKDKKIHLSEEPPIWGVRPAVDKLFISAAKVYGSHVLSVVLTGMGRDGAEGTKV
IKDLGGMTISEDKDTCTIYGMPKAAFETGKVDYVLPIYEISEAIAKNTIGSGR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaagtaatagttgtggatgattcagcacttatgagaaaaattatatca
gacatgataaacatgcaaccagatatggaagttatatgtacagccagaaatggggaagac
ctaataaaaaagcttgaaactgaaaagccagatgtaataactttagatatcgaaatgcca
aaaatgaatggaatggaaacattgcatgaaatgaagattaaaaaatataaaataccaaca
atcatgttaagtagtgtttcaaaagaaggaactaaacttacaatggaatgtctccataat
ggagcctttgattttatagcaaagccttctggagctatatcactggatattgaaaaggtt
ggtgatgaattggtaagtaaaattagggtttctaaaagcaaaaacaattttaaaattaaa
agaaatatagacaaaagtgctttatcaaaaactaaaataagaaggatgccaagcaaagta
ggaacgtcaaatatagaagcagttgttataggggcatctacaggaggacccaaagcatta
tacaaagttataacagagcttcctgaaaaattaggtgttccaatatttgtagtacaacat
atgccagtaggttttacaaaagcctttgcagataggcttgatgctaacagcaaaataaaa
gttattgaagcatcagaaggtgacattattaagaaagatgtagtgtatgttgcaaagggt
ggatctcatatggaaataacaaaggacaaaaagatacacttatctgaggagccaccaata
tggggagttagacctgctgttgacaagctatttatatctgcggctaaagtatatggttct
catgttttaagtgtagttttaactggtatgggaagagatggtgcagaaggaacaaaagtt
ataaaagaccttggaggaatgacaatttcagaagataaagatacttgcactatatatggt
atgcctaaagctgcctttgaaactggaaaggttgattatgtacttcccatttatgaaatt
tcagaggctatagctaaaaatactataggcagtgggaggtaa

DBGET integrated database retrieval system