KEGG   Clostridium novyi: NT01CX_2039Help
Entry
NT01CX_2039       CDS       T00431                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cno  Clostridium novyi
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NT01CX_2039
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NT01CX_2039
   00052 Galactose metabolism
    NT01CX_2039
   00500 Starch and sucrose metabolism
    NT01CX_2039
   00520 Amino sugar and nucleotide sugar metabolism
    NT01CX_2039
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NT01CX_2039
   00524 Butirosin and neomycin biosynthesis
    NT01CX_2039
Enzymes [BR:cno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     NT01CX_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1234306..1235274
Genome map
AA seq 322 aa AA seqDB search
MRIGIDLGGTNIAAGLVNNDGALIYKDSIKTNLECNGKFIIYDMVKLIESILIENNLKIS
DINSIGIGVPGTVKYEEGVVVECVNLHWKEVYLAKDINAKLKESFNTENDIKVFIENDAN
AAALGEYLAGSMKNCNSAILITLGTGVGGGMVLNGKVHRGKDGAALEIGHMIVGENFYNC
SCGNNGCFETFASATAIIKYAQELIKNGEKSIITDKVQGDLSKIDAKVVFDSAREGDKVG
NLTLDRFIKYLGTGINNIINILDLDVISIGGGVVAGSDLFMDRLINYINEHKLFKGLKLC
KIEKAELGNDAGIIGAALLDRM
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcgtataggtattgatttaggggggacaaatattgcagcgggtttagtaaataacgat
ggagcgttaatttacaaagatagcataaaaacaaacttagaatgcaatggtaaattcata
atatatgatatggtaaaattaatagaaagtattttaatagaaaataatttaaagataagt
gatataaattcaataggaataggcgtgccgggaactgttaaatatgaagagggcgttgtt
gttgaatgcgtaaatcttcattggaaggaagtttatcttgcaaaagatattaatgcaaaa
ttaaaggaaagttttaatacagaaaatgatattaaagtattcatagaaaatgatgctaat
gccgctgctttaggtgaatatttagctggtagcatgaaaaattgtaacagtgctatacta
ataacacttggaactggtgttggtggtggaatggtattaaacggaaaagtccatagagga
aaagatggagctgctttagaaatcggacatatgatagttggagaaaacttctataattgt
tcttgcggaaataacggatgttttgaaacatttgcatctgctacagcaatcataaaatat
gctcaagaattaattaaaaatggtgaaaaaagcataataactgataaagttcaaggagat
ttaagtaaaatcgatgcaaaagttgtgtttgattctgctagagaaggggacaaggttgga
aatcttacactagatagatttataaaatacctaggaactggaataaataacataataaat
atattagacttagatgttatttcaattggtggtggagtagttgcaggctctgacttattt
atggatagattaataaattatataaatgaacataagttatttaaaggattaaagctttgt
aaaatagaaaaggctgaactaggaaatgatgctggaatcattggagcagcattattggat
agaatgtaa

DBGET integrated database retrieval system