KEGG   Clostridium novyi: NT01CX_2099Help
Entry
NT01CX_2099       CDS       T00431                                 

Definition
glycosyl hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
cno  Clostridium novyi
Brite
Enzymes [BR:cno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     NT01CX_2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1295021..1295992
Genome map
AA seq 323 aa AA seqDB search
MQCASNKIINGIDISNWQSGINYDKLKRNTEVVIIKATEGVDFIDKMFLTHYNGCKTAGL
KIGFYHFFSDKSNPTKQARDFWNTIKNKKMHVIPVLDIETSKRSKTEVTNRCLEFLKEME
RLSGFKCIIYTYTSFAIEKLDKRLSSYPLWIAHYGVASPHNNGIWNKWVGFQYTDKARIE
GVPNTCDANKFTPYIFINSDFKVPQNNSIIQEKPLWQLSISGDIVKDLQRELNRQFNKGL
KVDGYFGNSTLNACILVRRGARGNITKIIQQRLIDKGYYVGIYKADGVFRNDTELAVKKF
QKNNNLKVDGIVGIETWKALFKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgtgctagtaataaaatcataaatggaattgatatttctaactggcaatcagga
ataaactatgataaattaaaaagaaatacagaagttgtcataataaaagctactgaaggt
gtagattttatagataaaatgtttttaacccattacaatggttgtaaaacagcaggacta
aaaattggattttatcatttttttagtgataaaagtaatcctactaaacaagcaagagac
ttttggaatactataaaaaataaaaaaatgcatgtaattcctgtacttgatatagaaacc
tcaaaacgaagtaaaactgaagttacaaatagatgtttagaatttttaaaggaaatggaa
agattaagtggatttaaatgtataatttacacttatacttcatttgccatagaaaaacta
gacaaaagactctcaagttatcctttatggatagctcattatggagtagcttctcctcat
aataatggtatctggaataagtgggtaggattccagtatactgataaagcaagaattgaa
ggggttccaaatacatgtgatgctaataaatttacaccatatatatttataaattcagat
tttaaagttccccaaaataatagtataatacaagaaaaacctctatggcaattaagcata
agtggtgatatagtaaaagacttgcaaagagaattaaatagacagtttaataaaggttta
aaagtagatggttactttggaaattccactttaaatgcctgtatactagttcgtagaggt
gctagaggaaatataacaaaaattattcaacaacgattaatagataaaggctactatgtt
ggaatttataaagctgacggtgtttttagaaatgatactgaacttgcagttaaaaaattt
caaaaaaataataatcttaaagtagatggtatagttggcatagaaacttggaaagctcta
tttaaaaaatag

DBGET integrated database retrieval system