KEGG   Clostridium novyi: NT01CX_2143Help
Entry
NT01CX_2143       CDS       T00431                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
cno  Clostridium novyi
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cno00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NT01CX_2143
Enzymes [BR:cno01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NT01CX_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1350554..1351711)
Genome map
AA seq 385 aa AA seqDB search
MKNICILGATGSIGTQTLDVIEKESNKFKLVAFSANKSYEKIITIIEKFNPVYGAINDKE
TFLKVKDHCNINNIKINLLYGMDGLIKISTLEEVELVVTSIVGMIGLVPTLEAINAGKDI
ALANKETLVTGGELVMKAAKQNNVKILPVDSEHGAIFQCLQGNSYKDIETIYVTASGGPF
RQSKLEELINITPEQALKHPKWNMGKKISIDSSTMINKGLEVIEAHWLFNVGYDKIKVLV
HPQSIVHSMVEYIDGSIIAQLASTDMRLPIQYALNYPVRNKKVVEKLDVYNMGNLTFEKP
DFEKFRGLKLAYEAGKLGGIMPTIFNASNEVAVNMFLNNHIKYLEIVDIVEECMNKFENK
SIKDVEDILNAEAKVRSFIKNKYNF
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatatgcatattaggagctactggttctataggaacacaaactctagatgta
atagaaaaggaaagtaataaattcaaattagtagctttttctgcaaataaaagctatgaa
aagattataactataatagaaaagtttaatccagtatatggtgctattaatgataaagag
acttttttaaaggtaaaagatcattgtaatataaataatataaaaataaacttattatat
ggaatggatggattaattaaaatatctactttagaagaagttgaattagtagtaacatct
attgtaggaatgattggacttgttccaacattagaggctattaatgcaggaaaagatatt
gccttagcaaataaggagactttagttacaggtggagaacttgtaatgaaggcagcaaaa
caaaacaatgttaaaattcttccagtagattctgaacatggagctatatttcagtgtctt
caaggaaattcctataaggatatagaaacaatctatgttactgcatcaggaggacctttt
agacaaagtaaattagaagagctaataaatatcacaccagagcaggccttaaaacaccct
aaatggaatatgggtaaaaaaatatcaattgattcttctaccatgataaataaaggatta
gaagtaattgaagctcattggttatttaatgtaggttatgataaaattaaagttcttgtc
catccacaaagtatagtccattcaatggtagaatacatagatggaagtataattgcacaa
ctagctagtacggatatgaggcttcctatacaatacgctttaaattatcctgttagaaat
aaaaaagtagtggaaaaactagatgtttataatatgggaaatttaacttttgaaaaacct
gattttgaaaaatttagaggattaaaacttgcatatgaagcaggaaaattagggggaata
atgcctactatttttaatgcttcaaatgaagttgcagtaaatatgtttttaaataaccat
attaaatatttagaaatagttgatattgttgaagagtgcatgaataagtttgaaaacaaa
agtataaaagatgtagaagatattttaaatgcagaagctaaagttaggtcatttataaaa
aataaatataatttttaa

DBGET integrated database retrieval system