KEGG   Cedecea neteri SSMD04: JT31_18075Help
Entry
JT31_18075        CDS       T03298                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
cnt  Cedecea neteri SSMD04
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnt00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    JT31_18075
   00500 Starch and sucrose metabolism
    JT31_18075
Enzymes [BR:cnt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     JT31_18075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3831655..3833097)
Genome map
AA seq 480 aa AA seqDB search
MTTPLIKAQAALETLQATRGNAFYPLYHLAPPAGWMNDPNGLIYHNGLYHAFYQHHPFDE
NWGPMHWGHATSRDMVRWEHQPIALAPGNEWDRDGCFSGSAVDDNGVLSLIYTGHIWLEG
AGNDSAIRQVQCLATSEDGVHFTKQGVILTPPPGIMHFRDPKVWQQDGNWWMVLGARDQH
DRGKVLLYRGNSLREWRLDRILTEADAGMGYMWECPDFFPLGNSQILMFSPQGIPAQGLK
YQNLFQSGYLRGRWQPGEAFRLCQPFEEMDHGHDFYAPQSFVAADGRRIVMGWMDMWESP
MPSKGEGWAGCLSLPREVCIMPNGKLYQNPVHELATLRTHEQLVLPCVLDKLNQRLLPDA
QAVELEIAWECGQSTAERYGIRLGQGCELFVDAQARRLVLSRSYQDERLCGDRSVPLSEN
GDLHLRIFIDRSSIEVFVNQGEYCLSSRLYPRSGERQLELFASHGKALCRGGTLWQLNSL
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgactaccccacttatcaaggcacaagcagccttagaaacgctgcaggcaacgcgcggg
aacgccttttatcctctttatcatctggcgccgcccgcgggctggatgaacgatcctaac
ggcctgatttatcacaacgggctgtaccacgccttctatcagcaccatccgtttgatgaa
aactgggggccgatgcattggggacatgccaccagccgggatatggtgcgctgggagcac
cagcctatcgctctggctccgggtaacgaatgggacagagatggctgcttctccggcagc
gcggttgacgataacggcgtgctctcgctgatttacaccgggcatatctggcttgaaggt
gcgggaaatgacagcgctatacgccaggtacaatgcctcgcgaccagcgaagacggtgtt
cactttacgaaacagggcgtcattcttaccccaccgcccggcatcatgcatttccgcgat
ccgaaggtctggcaacaggacggcaactggtggatggtactcggcgcacgcgaccagcac
gatcggggcaaagtactgctttatcgcggcaattcactgcgggagtggcggctggatcgt
atcctcacggaagccgacgcgggtatgggctatatgtgggaatgtccggatttcttcccg
ctcggcaacagtcaaatcctgatgttttcccctcagggcatcccggcacagggcttgaag
tatcagaatctgttccagagcggctatctgcgcggcagatggcaaccgggggaagcattc
aggctctgtcagccgtttgaagagatggatcacgggcacgacttttacgcgccgcagtcc
tttgtcgccgccgatggccgccgcatcgtgatgggctggatggacatgtgggaatccccc
atgccctctaaaggcgaaggctgggcgggctgcctcagcctcccccgggaagtgtgcatt
atgccaaacggaaaactctatcagaatccggtgcacgaactggccacgctgcgcacccat
gaacagctggttctgccctgcgtgctggataaacttaaccagaggctgctgcccgatgcg
caggcggttgagctggagatagcctgggagtgtgggcaaagcacggctgagcgctacggc
atccgtctggggcaaggctgcgaactgtttgtcgacgctcaggcgcggcgcctggtgctg
tcacgcagctatcaggatgagcggctttgcggggatcgcagcgtgccgttatcggaaaac
ggcgatcttcatctgcgtatttttatcgatcgttcttctatcgaggtttttgttaaccag
ggcgaatactgcctcagcagccgtctctacccgcggtcgggagaacgtcagcttgagctg
ttcgccagccacggaaaagccttatgtcgtggcggcaccctgtggcagctgaactcgcta
taa

DBGET integrated database retrieval system