KEGG   Corynebacterium sp. ATCC 6931: DR71_714Help
Entry
DR71_714          CDS       T03283                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
coa00071  Fatty acid degradation
coa00072  Synthesis and degradation of ketone bodies
coa00280  Valine, leucine and isoleucine degradation
coa00310  Lysine degradation
coa00362  Benzoate degradation
coa00380  Tryptophan metabolism
coa00620  Pyruvate metabolism
coa00630  Glyoxylate and dicarboxylate metabolism
coa00640  Propanoate metabolism
coa00650  Butanoate metabolism
coa00900  Terpenoid backbone biosynthesis
coa01100  Metabolic pathways
coa01110  Biosynthesis of secondary metabolites
coa01120  Microbial metabolism in diverse environments
coa01130  Biosynthesis of antibiotics
coa01200  Carbon metabolism
coa01212  Fatty acid metabolism
coa02020  Two-component system
Module
coa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:coa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR71_714
   00630 Glyoxylate and dicarboxylate metabolism
    DR71_714
   00640 Propanoate metabolism
    DR71_714
   00650 Butanoate metabolism
    DR71_714
  Lipid metabolism
   00071 Fatty acid degradation
    DR71_714
   00072 Synthesis and degradation of ketone bodies
    DR71_714
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR71_714
   00310 Lysine degradation
    DR71_714
   00380 Tryptophan metabolism
    DR71_714
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR71_714
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR71_714
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DR71_714
Enzymes [BR:coa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR71_714
Exosome [BR:coa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR71_714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIN81942
UniProt: A0A088QET6
Position
805036..806358
Genome map
AA seq 440 aa AA seqDB search
MAAQANNNSLRRAVVVGGNRIPFARSNKEYANESNQDMLTAAIDGLVARFGIGGERLGAV
SAGAVLKHSRDFNLTRECVLGSALAPDTPAFDIQMACATGMEALNSVSNMIKLGQIDSAI
AGGVDTTSDAPIAVNDRLRKILLEASRQKSTLDMAKVFLKTRPSDLAPDTPSTGEPRTGL
SMGEHQAITTAKWGVTRAEQDELAAASHQNMANAYDEGFFTDLVTPYKGVSRDTNMRPDS
TPEKLAKLKPVFGRGLEAEPTMTAGNSTPLTDGASAVLVSTPEWAAERGLPVLADVVDSE
AAAVDFVHGDEGLLMAPAYATPRLLARNGWTFDDFDFFEIHEAFAGTVLSTMKAWEDEEF
CRTKLGLEGPLGSIPREKLNVKGSSLAAGHPFAATGGRIVAALAKMLRQKADETGKTTRG
LISVCAAGGQGVVAVLEARV
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcaggccaacaataactctctgcgccgcgcggtcgtcgtcggcggtaaccgc
attccgttcgctcgttctaataaggaatacgctaacgagtcgaaccaggacatgctgacc
gctgcaatcgacggtctcgtcgcccgcttcggtatcggcggcgaacgcctcggtgcagtc
tccgccggcgctgtgctgaagcactcccgtgactttaacctcacccgtgagtgtgtcctc
ggctccgcactggcgccggacaccccggctttcgacattcagatggcatgtgccaccggc
atggaggccctcaactctgtctccaacatgattaagctgggccagattgactccgctatc
gccggcggtgtggacaccacctccgacgctccgattgctgtcaacgaccgtctgcgcaag
atcctgctggaggccagccgccagaagtccactctggacatggcaaaggtcttcctgaag
acccgtccgtccgacctggctccggatactccgtcgaccggcgagccccgcactggcctg
tccatgggtgaacaccaggccatcaccaccgccaagtggggcgttacccgagctgagcag
gatgagctcgccgccgcttcccaccaaaacatggcaaacgcttacgacgagggcttcttc
actgacctcgtcaccccgtacaagggcgtttcccgtgacaccaacatgcgcccggactcc
accccggagaagctggccaagctcaagccggtcttcggccgcggcctggaagcagagccg
accatgaccgccggtaactccactccgcttaccgacggcgcctctgccgtcctcgtctcc
accccggagtgggccgctgagcgcggtctgccggtgcttgccgacgtcgtcgattccgag
gcagccgcagttgactttgtccacggcgacgagggtctgctgatggctccggcttacgcc
accccgcgcctgctggcccgcaacggctggaccttcgacgacttcgacttcttcgagatc
cacgaggctttcgccggcaccgtcctgtccaccatgaaggcatgggaggacgaggagttc
tgccgcaccaagcttggactggaaggcccgctgggctccatcccgcgcgagaagctcaac
gtcaagggctcttccctggcagccggccacccattcgccgctaccggcggccgcattgtg
gcagccctcgccaagatgctgcgccagaaggcagacgagaccggcaagaccactcgcggc
ctgatctccgtctgtgccgcgggcggccagggtgttgtcgcagttctcgaggctcgcgtc
taa

DBGET integrated database retrieval system