KEGG   Corynebacterium sp. ATCC 6931: DR71_926Help
Entry
DR71_926          CDS       T03283                                 

Definition
(GenBank) putative acyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
coa  Corynebacterium sp. ATCC 6931
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:coa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DR71_926
   00630 Glyoxylate and dicarboxylate metabolism
    DR71_926
   00640 Propanoate metabolism
    DR71_926
   00650 Butanoate metabolism
    DR71_926
  Lipid metabolism
   00071 Fatty acid degradation
    DR71_926
   00072 Synthesis and degradation of ketone bodies
    DR71_926
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DR71_926
   00310 Lysine degradation
    DR71_926
   00380 Tryptophan metabolism
    DR71_926
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DR71_926
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DR71_926
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    DR71_926
Enzymes [BR:coa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DR71_926
Exosome [BR:coa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DR71_926
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1041818..1043053
Genome map
AA seq 411 aa AA seqDB search
MTSATIQPGGEAFIYEAIRTPRGKGKKDGSLHEVRPVSLLVGLIDEIRNRFPELDEERIS
DLIVGCVSPVGDQGADIARTAALTAGLPYRTGGVQINRFCASGLSAINLAAQKVRSGMDE
LVLAGGVESMSRVPMMSDGGAMAMDAQVSFATDFVPQGISADLIASLDGFDRESLDEMAA
LSHARAAKAWSEGRFDRSVVPVKDANGLTILDRDETIREGVSAESLAGLRAAFTMMGEQG
GFDAVALKKYPQLERINHVHHAGNSSGIVDGAALTLVGSEKAGADMGLTPRARVVATAVN
GVEPTIMLTGIEPAVREALAKANLTVDDIDVWEINEAFAAVVKHAQQNLGIDYEKLNING
GAMAMGHPLGATGAMITGAAIDELHRTGGRYALISLCVAGGMGVATIIERV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgccaccattcagccgggcggcgaagccttcatctacgaggcaattcgcacc
ccgcgcggcaagggcaagaaggacggctccctccacgaggtacgcccggtatcacttctc
gtcggcctcatcgacgaaattcgcaaccgcttcccggagctggatgaagaacgcatcagc
gacctcatcgttggctgcgtcagcccggtcggcgaccagggtgcggacattgcccgcacc
gcagcactcaccgcaggtctgccgtaccgcaccggcggtgtccagatcaaccgcttctgc
gcttcaggcctctccgccatcaacttggctgctcagaaggtccgctccggcatggacgag
ctcgtcctcgccggtggcgtcgagtccatgtcccgcgtgccaatgatgtccgacggcggc
gcaatggcaatggatgcacaggtctcgttcgcaactgacttcgtcccgcagggtatctcc
gctgacctaattgcatcgcttgacggctttgaccgcgagtccctcgacgaaatggcagca
ctctcccacgcccgtgccgcaaaggcttggtctgagggtcgcttcgaccgctccgtcgtc
ccggtcaaggacgctaacggcctgaccatcctcgaccgcgatgagaccatccgcgagggc
gtctccgcagagtccctggccggcctgcgcgcagccttcaccatgatgggtgagcagggt
ggcttcgacgcagttgcactgaagaagtacccgcagctcgagcgcatcaaccacgtccac
cacgcaggtaactcctccggcatcgtcgatggcgctgcactgaccctggttggttctgag
aaggctggcgcagacatggggctgaccccgcgcgcacgcgttgtcgccaccgccgtcaat
ggtgtcgaaccgaccatcatgctcaccggtatcgagccagccgtccgcgaggctctggcc
aaggccaacctgacggtcgacgatatcgacgtgtgggaaatcaacgaggcgtttgccgcc
gtcgtcaagcatgctcagcagaacctgggcatcgactacgagaagctcaacatcaacggc
ggcgcgatggccatgggtcacccgctgggggcaaccggtgccatgatcaccggcgccgca
atcgatgagctgcaccgcaccggtggccgctacgccctcatttcgctctgcgtggctggc
ggcatgggtgttgcaaccatcatcgagcgcgtctaa

DBGET integrated database retrieval system