KEGG   Caldicellulosiruptor obsidiansis: COB47_0089Help
Entry
COB47_0089        CDS       T01293                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    COB47_0089
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    COB47_0089
Enzymes [BR:cob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     COB47_0089
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
107794..109137
Genome map
AA seq 447 aa AA seqDB search
MFKKIASYVTAKDQSIPMQQVDNIKECQKIKNETIITIDPSCTFQEVIGFGGALTEAAAV
NILSLLPQQQEEILRGYFDPKDGLGYKLCRIHMNSCDFCTDSYSCDDVEGDTDLKYFNIE
RDKKMVIPLLKRIKEYCPDLKILVSPWSPPAWMKTNGDMCHGGKLKDEYKKTWARFFCKF
IKAYKEEGIDIWAVTVQNEPMATQVWESCIYTAEEERDFVKDYLGPTLEEEGLSHIKILI
WDHNKDIIYDRVKTILSDKDAAKYVWGVAFHWYGGDHFDQLKKIKEEFPYVNLVFTEGCQ
EGGVKLGSWELGERYAHEIIGDFNSYTIGFMDWNIVLDTVGGPNHVGNFCDAPIVVDKNE
KKIYYQNAYYYIGHFSKFIKPGAKIVASNCNNPKLEVLVGRNNDNSLVIVIFNKNQEEIE
FGIKIAGEIFSGKSSARSISTIILQNQ
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaaattgcaagttacgtaactgccaaggatcagagtattcctatgcagcaa
gtagacaatataaaagagtgccaaaaaataaaaaatgagactattataacaattgatcca
tcttgtacatttcaagaggtaataggatttggaggagcacttacggaggctgccgcggta
aatatactgtcacttttaccccagcaacaagaagagattttaagaggttactttgatcca
aaagatgggcttggctacaaactctgtagaatccatatgaacagctgtgatttttgtaca
gacagctatagctgtgatgatgttgaaggtgatactgatcttaaatattttaacattgag
agagacaaaaagatggtaattcctcttttaaaaagaataaaggaatattgtccagatctc
aaaattcttgtttcaccttggagtccgcctgcatggatgaaaacaaacggtgatatgtgc
catggtggaaagctaaaggatgagtataaaaaaacatgggcaagatttttctgcaaattc
ataaaagcatataaagaagaaggaattgatatatgggcagtgacagttcaaaatgagcct
atggcaactcaggtgtgggagtcgtgtatatacacagctgaagaagaaagagattttgtg
aaggattacttagggccaactcttgaggaagaagggctttcccatataaaaatacttata
tgggaccacaacaaagatatcatatatgatagggtaaaaacaattttgagtgacaaagac
gctgcaaagtatgtgtggggagttgcattccactggtatggaggggaccattttgaccag
ctcaaaaaaataaaagaagagtttccttatgtcaatttagtgtttaccgaaggttgtcag
gaaggtggagtaaagcttggttcctgggagcttggagaaaggtatgctcatgagataatt
ggagattttaacagctacacaattggatttatggattggaatattgttcttgacacagtt
ggaggtcccaatcatgttggcaatttttgcgatgccccgatagttgttgataaaaatgag
aaaaagatttactatcaaaatgcatattattatattgggcatttttcaaaatttataaag
ccgggagctaaaattgtcgcaagtaattgtaataatccaaaacttgaagttttagtaggc
agaaataatgataatagcttggtaatagttatttttaacaaaaatcaggaagaaatagaa
tttggtataaaaatagctggagaaatctttagcgggaaatcttctgcgaggtctatttct
acaattattttacaaaatcaatag

DBGET integrated database retrieval system