KEGG   Caldicellulosiruptor obsidiansis: COB47_0208Help
Entry
COB47_0208        CDS       T01293                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    COB47_0208
Enzymes [BR:cob01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     COB47_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
262465..263589
Genome map
AA seq 374 aa AA seqDB search
MRLISKDANLKRILYQKGFDEKDILEFEKKANSIILRFDDVKNPSRFVQLLSNLGYFTIT
NGNICFATTSLYNFEKTRCILAEAGIDCNFDGDFTISQRCLLAKDKQISLLKTNVMGIIN
VTPDSFYEGSRVQVDKVTQRALQMIQDGADVIDIGGESTRPFSDPVCEEEELKRVIPAIE
AIRKVDKNIPISIDTYKSRVAQKAIEAGADIINDISGGTFDKDMFYVAAQYNVPIIIMHI
KGTPKDMQKNPYYEDVIEEILQFFEERIEQALKAGVKLENIILDPGIGFGKRPEDNLEIL
RRCEEFKVLGRPILIGASRKSVIGYVLGNLGPEERLEGTVAVSVICAQKKIEFVRVHDVK
ENKRAILMTQAIFC
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
ttgaggttgatttcaaaagatgcaaatttaaaaaggattttgtatcaaaaaggttttgat
gaaaaagacattttggaatttgaaaaaaaagcaaactcaataatcttaagatttgatgat
gtgaaaaatccatcaaggtttgtccagcttctttcaaaccttggttattttacaatcaca
aacggcaatatatgctttgcaacaacatcactttacaactttgaaaagacaagatgtatt
ttagctgaggcagggatagattgcaattttgatggagattttaccatttcgcaaaggtgc
ttactggcaaaagataagcaaataagtcttttgaagacaaatgttatggggattataaac
gttacacctgactcgttttatgagggttcaagagtccaggttgataaagtgactcagaga
gcactgcagatgattcaagatggtgcagatgtcattgatattggaggtgagtcgacaaga
cctttttcagacccggtttgtgaggaagaagaactaaaaagggtaattcctgcaattgaa
gcgataagaaaagtggataagaacattccaatttcgattgatacatacaagagcagggtg
gctcaaaaagcgatagaagccggtgctgacattataaatgatatcagcggcgggacgttt
gacaaagacatgttttacgtggcagcacagtataatgttcctatcataattatgcacatc
aaaggcacgccaaaggatatgcagaaaaatccttactatgaagatgtgattgaagagatt
ttacagttttttgaggaaaggattgaacaggcgctaaaagctggtgtaaaacttgaaaac
atcattttggaccctggcattggctttgggaaaagacctgaggacaatttggaaatactg
cgaaggtgtgaagagttcaaggttttaggaagaccaattttgattggggcatccagaaaa
tcggtgattggttatgtgcttggtaatcttggacctgaggagagactggaaggtactgtt
gctgtctctgtaatatgtgctcagaagaagattgaatttgttagagtacatgatgtaaaa
gaaaacaaaagagctatcttgatgacacaggcaatattttgctga

DBGET integrated database retrieval system