KEGG   Caldicellulosiruptor obsidiansis: COB47_0383Help
Entry
COB47_0383        CDS       T01293                                 

Definition
dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COB47_0383
  Amino acid metabolism
   00300 Lysine biosynthesis
    COB47_0383
Enzymes [BR:cob01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     COB47_0383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459363..460754
Genome map
AA seq 463 aa AA seqDB search
MDEVKALIDKEIEDLKDDIINTTVQLIKIRSVEDMPAPNMPFGKAINDALLTCENLCKNL
GFETKNYDGYALEAVYGNQDEDVCVIGHLDVVPEGEGWSVPPYEGVVKDGKIFGRGAVDD
KGPTVAALYGMYVLKKLAEEKKISLKRKLRFVFGTNEEGGSKCLQYYFERAKYPTVGFTP
DADFPVIQGEKGFLVFEFAKDVEDTFEIEGGQRPNMVPDRCRFEGSFDVQKAKEIIAKKG
LNDKAEVFEEAGKTIIVTKGVSAHGSLPFKGENAISYMFDILDELWTKEDEFRRFIDFYN
THIGFDVFGEKLSIGFEDEKSGKLVLNAGMIRKEKDKLILTINVRYPVDTSYDEIEKIVK
EVVQNYNIEYRLVTNVPPLYFEADHFLIRTLLEVYREFTNDDTQPLVIGGGTYARWAKNV
VAFGPNMPGDEEVAHQKDEYILIDRLMLCSKIYANAIYRLAKE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggtaaaagcgctgatagacaaagaaattgaagatttaaaagatgatataata
aatactactgtgcagcttataaaaatcaggagcgttgaggatatgcctgcacctaatatg
ccgtttggcaaggcaataaacgatgcgctacttacgtgtgaaaatctttgcaaaaacttg
ggatttgaaacaaagaactatgacggatatgcgcttgaggcagtatatgggaatcaggat
gaggatgtgtgcgtgataggtcatctggatgttgtacctgagggggaaggctggagcgta
ccgccttatgaaggtgttgtaaaggacggtaaaatttttggacgtggtgcagttgatgat
aaaggtccaactgtggcagctctttatggcatgtatgtgcttaaaaagcttgccgaagaa
aagaagatttctcttaaaagaaagctcaggtttgtatttggtacaaacgaagaaggtggt
tctaaatgtctgcagtattattttgaaagagcaaaatatcctactgttgggtttactcca
gatgccgattttccagtcatccagggtgaaaaaggttttttggtgtttgagtttgcaaaa
gatgtggaagatacctttgagattgagggtggacagcgacctaacatggtgcctgacagg
tgcaggttcgaaggtagttttgatgtccaaaaagccaaagaaattattgccaaaaaagga
ctaaatgataaggcagaggtttttgaagaagctggcaagacaattatagttacaaaggga
gtatctgcccacgggagcctgccttttaagggcgagaatgccatatcttatatgttcgat
attttagatgagctttggacaaaagaggatgagtttagaagatttattgacttttacaat
actcatattggatttgacgtgtttggcgagaaactctcaattggatttgaggatgaaaag
tcaggtaagcttgtgttaaatgccgggatgatacgcaaagaaaaagataaacttatcctt
acaataaatgttcgatatccagttgacacctcatatgatgagatagaaaagatagtaaaa
gaagtagttcaaaattacaatattgaatatcgacttgtcacaaacgttccccctctttat
tttgaagctgaccactttttaatcagaacgttgcttgaggtttacagagaatttacaaat
gacgatacacagccgcttgtgattggcggtggaacatacgcaaggtgggcgaaaaatgtt
gttgcttttggtccaaatatgccgggtgatgaagaggttgcacaccaaaaagatgaatat
atccttatagacaggctcatgctgtgtagcaaaatctatgcaaatgctatttacagactt
gccaaagaatag

DBGET integrated database retrieval system