KEGG   Caldicellulosiruptor obsidiansis: COB47_0428Help
Entry
COB47_0428        CDS       T01293                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cob00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cob00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cob00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
513656..515845
Genome map
AA seq 729 aa AA seqDB search
MPITFNPQTNMFFIEAKNTSYVIKLFKGKFLCHVYWGKKTREFEWTDFDVTGGRAFGPTP
DPNDKSYTFDTMLLEYPAYGNSDFRHPAYQVQQEDGSRITNLVYKAHRIYDGKPKLEGLP
ATYVESSDEAQTLEIDLYDDLIDLKVTLIYTAFRDYDAITRSVRFENLGKQKLKILRAMS
TCVDFQEGDFELLHLWGAWARERYIERKEIIHGQQIIESSRGESSHQHNPFIALVRKDAN
EDYGDVYGFSLVYSGNFSAIVEKDQYNFVRVTMGINPFEFTWILEPHSSFQTPEVVMVYS
DQGLGKMSRTYHKLYRKRLCRGVWRDRRRLVLINNWEATYFNFNEEKLLALAKEAKELGI
ELFVLDDGWFGKRDDDTSSLGDWFVDKRKLPNGLDGFGKKLNEMGLKFGLWFEPEMISPN
SELYRKHPDWCLQVKGRTLTQCRNQYVLDITREDVRKEILRMMKEILKTAPIEYIKWDMN
RPLTEAYSLALPPERQKEVFHRYVLGLYQMMEELVTEFPYILFEGCSGGGGRFDPGILYY
MPQIWTSDDTDAIERLKIQFGTSIVYPASTMGAHVSIVPNHQVGRITPMKTRGVVALSGA
FGYELDLTKLSPEDKEEIKRQIETYKEIWHIVFEGELFRLISPFEEDAAAWMFVTEDKRE
AVVFYVEVLKSPNKHPRRLKLKGLLPEKKYFIKELNTSKFGDELMNLGIFIPEMWGDFNS
KMWTLKALD
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgccaataacctttaacccacaaacaaatatgtttttcatagaagcaaagaacacaagc
tatgttataaagcttttcaaaggtaagtttttgtgtcatgtttactggggcaaaaagact
agggagtttgagtggacagattttgatgtgacaggcggcagagcgtttggtccaactccc
gacccaaacgacaaatcttatacatttgatacaatgcttttagaataccctgcgtatggc
aactcagatttcagacaccctgcatatcaagttcagcaagaagatggttctcgtataaca
aaccttgtttataaagctcacagaatctatgatgggaaaccaaaacttgaaggtcttcct
gcaacatatgtagagtcatctgatgaggctcaaacactggaaatagacctttatgatgat
ttgattgacttaaaagtcacattgatatatacagctttcagagattatgatgcgataacg
agaagcgtaagatttgagaacttaggaaaacaaaaactcaaaatccttcgtgcgatgagt
acatgtgttgactttcaagaaggagattttgaacttttgcacctgtggggggcttgggca
agagaaaggtatattgaaagaaaagagattattcatggtcagcagattatagaaagttca
agaggtgaaagttctcatcagcacaatccatttatagctcttgttagaaaagatgcaaac
gaagattacggagatgtgtatggtttttctcttgtctacagtggaaatttttctgcaatt
gtcgaaaaagaccagtacaattttgtaagagttactatgggaataaatccatttgaattt
acatggattttagagccgcatagcagttttcagacacctgaggttgtaatggtgtattca
gaccaaggtttgggtaagatgtctcgcacgtaccataagctttacagaaaaaggctttgc
agaggtgtttggagagatagacgaagacttgtgcttatcaataactgggaagccacatat
tttaatttcaatgaggaaaagcttttggctttggcaaaggaagcaaaagaacttggcatt
gaactttttgttcttgacgatggatggtttggtaaaagagatgatgatacaagctcgctt
ggcgactggtttgttgataaaagaaaattgcccaatggtttagatggttttgggaaaaaa
ttaaatgagatggggctcaagtttggactttggtttgagcctgagatgatctcaccaaac
agtgagctttacagaaagcatcctgactggtgtttgcaggttaaaggtagaacccttacc
cagtgcagaaatcaatatgtgttagacataacaagagaagatgtaagaaaagaaattcta
aggatgatgaaagagattttgaaaacagctccaattgaatacatcaagtgggacatgaac
agacctttgacagaggcttattctcttgctcttccaccagagaggcaaaaagaagtcttt
catagatatgtcttggggctgtatcaaatgatggaagaacttgtgacagaatttccatat
attttatttgaaggatgttctggcggtggtggaaggtttgatcccggaattttatattac
atgccacagatttggacaagtgacgacacagatgcgatagaaaggttaaagattcagttt
ggaacaagcatagtgtatcctgcatcaacaatgggtgcgcatgtgtcaattgtgccaaac
catcaggttggaagaataacaccaatgaaaacaagaggagtggttgcattatctggtgct
tttgggtatgagcttgacctgaccaagctttctccagaagataaggaagagattaaaagg
cagatagaaacttacaaagagatttggcatatagtatttgaaggagaacttttcagatta
atttctccttttgaagaagatgcggctgcttggatgtttgtaactgaagacaaaagagaa
gctgttgtattttatgttgaagttttgaaatctcctaataaacatccaagaaggttaaaa
ttgaaaggtcttttgcctgagaaaaagtattttattaaagaacttaatacatcaaaattt
ggcgatgaacttatgaatcttggaatttttattcctgagatgtggggagattttaattcg
aagatgtggacattaaaagcacttgattag

DBGET integrated database retrieval system