KEGG   Caldicellulosiruptor obsidiansis: COB47_0546Help
Entry
COB47_0546        CDS       T01293                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    COB47_0546
Enzymes [BR:cob01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     COB47_0546
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635534..637240
Genome map
AA seq 568 aa AA seqDB search
MKRTILRFSKFLKIVILITFTLQIFTVFAKNTPYESRKYPHLLGNQAVKKPSVAGRLRII
EKNGKKYLADKKGEIIQLRGMSTHGLQWYGDIVNRNAFAALSKDWGCNVIRLAMYVGEGG
YASNPGIKEKVVKGIKLAIENDMYVIVDWHVLNPGDPNAQIYKRAKDFFKEIATSFPNDY
HIIYELCNEPNPNEPGVENSLDGWKKVKAYAQSIIKMLRSLGNQNIIIVGSPNWSQRPDF
AIQDPIDDKNVMYSVHFYSGSHPVGGYVFENMKKAFENGVPIFVSEWGTSLASGDGGPYL
DEADKWLEYLNANYISWVNWSLSNKNETSAAFVPYVSGMHYATSLDPGNDKKWDMKELSI
SGEYVRARIKGIAYNPIKRDKGIKCPFKDLNEDNIFYEQVVKLYSKGIIKGTLSSKYLPD
KNITRAELAALCVRLLNLKIEKYDGRFSDVKSSDWYADVVYTAYKNGLFKQEEEKKFFPE
RITKREEVATLAIEVYKRLIGKLEVNVDDIQVVDEDLIKPQYRECVKLAVYLGIIDLDSD
GTFAPSKSVSRGEAATIFYNVLNLAGKL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaactattttaagatttagtaaattcttaaaaatagtgattttaattactttc
actttgcaaatatttactgtgtttgctaagaatacaccatatgaaagtaggaaatatcca
caccttcttggtaaccaagcggtgaaaaaaccatcagttgctggcaggctccgtattatc
gaaaagaacggtaaaaagtatttagctgacaagaaaggcgaaataattcagcttcgtggc
atgagcacgcatggactccagtggtatggtgacattgtaaacagaaatgcgtttgctgct
ctttcaaaagattggggatgcaatgttataaggcttgcgatgtatgtgggtgaaggtggt
tatgcttcaaatccaggcattaaagaaaaagttgtaaagggaataaaacttgcaattgaa
aatgacatgtatgtgattgttgactggcatgtgttaaatccaggcgacccgaatgcccaa
atttataaaagagcaaaagactttttcaaagagatagctacaagttttcccaatgactat
cacataatatatgaactttgtaatgaaccgaatccaaatgagccgggagtagaaaatagc
ttggatggttggaaaaaggtaaaggcttatgcgcagtccatcataaaaatgctcagaagt
ttggggaatcagaacattataattgtaggttcgcccaattggagtcaaagacccgacttt
gcaattcaagatcctatagacgataaaaacgttatgtattcagtacatttttattctggg
tctcatcctgtaggtgggtatgtttttgaaaacatgaaaaaggcatttgaaaatggtgtg
ccaatttttgtgagcgaatggggaacaagtttggcaagcggtgatggtggaccatatctt
gatgaggcggataagtggcttgagtatttaaatgcaaactatattagctgggtgaactgg
tcactatcaaacaaaaatgaaacatcagctgcttttgtcccgtatgttagtggcatgcat
tatgccacttcacttgatcctggcaatgataagaagtgggatatgaaagagcttagtata
tccggagagtatgtgagagcacggataaaagggattgcatataaccctataaagagagac
aaaggaataaaatgtccttttaaagatctcaatgaagataatattttttatgaacaagta
gtaaaactttattcaaaaggaattataaaaggtactttatcttctaagtatttgcctgat
aaaaacatcacaagggctgaacttgctgcactatgtgtaagattattgaatctgaaaatt
gaaaaatatgacggcaggttttctgatgtaaaaagtagtgactggtacgcagatgtggtt
tatacagcatataaaaatggtttgtttaaacaagaagaagaaaagaaatttttccctgaa
agaatcactaaaagagaagaagtagctactttggcaatcgaagtatacaaaagattgata
ggtaaattagaggttaacgtggatgatattcaagttgtcgacgaagaccttataaagcct
caatatagagagtgtgtgaaattagcagtttatcttggtattattgacttggattcagac
ggaacctttgcaccaagtaagagcgtttcgagaggggaggcagcaacaattttttataat
gttttgaacttagcaggcaagctatga

DBGET integrated database retrieval system