KEGG   Caldicellulosiruptor obsidiansis: COB47_0553Help
Entry
COB47_0553        CDS       T01293                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:cob00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cob00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
646425..647741
Genome map
AA seq 438 aa AA seqDB search
MKYFKDIPEVKYEGPKSDNPFAFKYYNPDEIIDGKPLKDHLRFAVAYWHTFCATGSDPFG
QPTITRPWDRFSNPMDNAKARVEAAFEFFEKLNVPFFCFHDRDIAPEGENLRETNKNLDE
IVSMIKEYLNTSKTKVLWGTANLFSHPRYVHGAATSCNADVFAYAAAQVKKALEVTKELG
GENYVFWGGREGYETLLNTDMELELDNLARFLRMAVDYAKEIGFDGQFLIEPKPKEPTKH
QYDFDAAHVYGFLKKYDLDKYFKLNIEVNHATLAGHDFHHELRFARINNMLGSIDANMGD
LLLGWDTDQFPTDVRLTTLAMYEVIKMGGFDKGGLNFDAKVRRSSFELEDLVIGHIAGMD
AFAKGFKIAYKLVKDGVFDKFIEERYRSYKEGIGAKIVSGQADFKTLEEYALNLSQIENK
SGKQELLEMILNKYMFSQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacttcaaagacattccagaagtaaaatatgaaggaccaaagtcagacaatcca
tttgctttcaagtactacaatcctgacgaaattattgacggcaagcctttgaaagaccac
cttcgttttgcagttgcttactggcatacattctgtgcaacaggaagcgacccgtttgga
caacctacaattacccgtccatgggacaggttctcaaacccaatggacaacgcaaaggca
agagttgaagccgcatttgagttttttgaaaagctaaatgttccatttttctgttttcat
gacagagacattgcacctgaaggagaaaatttaagagaaacaaacaagaacttggatgag
atagtttctatgatcaaagaatacttaaacacaagcaaaacaaaagttttgtggggaaca
gcaaacctattttcacatccgcgatatgttcatggtgctgcaacatcctgcaatgccgat
gtttttgcatatgcagcagcgcaggtgaaaaaggcgttagaggtaacaaaagagcttggc
ggcgaaaactatgtgttctggggcggaagagaaggttatgagacgcttttgaacaccgac
atggagcttgagcttgacaacttggcaagatttttgcgcatggcagttgactatgcaaaa
gagatagggtttgacggtcagtttttgattgaaccaaagccaaaagaaccaactaagcat
cagtacgattttgatgctgctcatgtatatggatttttgaaaaagtatgatcttgataag
tacttcaagctcaacatagaagtaaaccatgcaaccttggcaggacatgattttcaccat
gagttgagatttgcacgaataaacaacatgcttggttcaattgatgctaacatgggcgat
ttgcttttgggttgggatacagatcagttcccaacagatgtaaggcttaccacgcttgct
atgtatgaggttataaagatgggtggttttgacaaaggtgggctcaactttgatgcaaag
gtaagaagaagctcttttgaacttgaagacctggttattggtcacattgcggggatggat
gcttttgcaaaaggatttaagatagcatataagcttgttaaagatggggtatttgataag
tttatcgaagagagatacagaagctacaaagaaggaattggagctaagattgtaagtggt
caggcagattttaagacgttagaagagtatgctctaaatctttctcaaatagaaaacaaa
tctggcaaacaagagcttcttgagatgattttgaacaaatatatgttcagtcaatga

DBGET integrated database retrieval system