KEGG   Caldicellulosiruptor obsidiansis: COB47_0611Help
Entry
COB47_0611        CDS       T01293                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
cob00260  Glycine, serine and threonine metabolism
cob00750  Vitamin B6 metabolism
cob01100  Metabolic pathways
cob01110  Biosynthesis of secondary metabolites
cob01120  Microbial metabolism in diverse environments
cob01230  Biosynthesis of amino acids
Module
cob_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COB47_0611
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    COB47_0611
Enzymes [BR:cob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     COB47_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Baculo_LEF-11 Ntox44 Orthopox_F8
Motif
Other DBs
NCBI-ProteinID: ADL41929
UniProt: D9TIU7
Position
715926..717407
Genome map
AA seq 493 aa AA seqDB search
MRYISTRGNKEVQAKEAIYRGIAEDGGLYTPVSIPSLDLSKIKNIDSYENLAKYIFELYL
TDFTNDEIADCIDKSYSRGKFDTKDVVTIKKLSSSLFALELWHGPTYAFKDVALQVLPHL
LLKSMPTFYKQALILVATSGDTGKAALEGFRDVDRTKIVVFYPSEGVSEVQKRQMITQEG
RNTFVAGIKGNFDDAQSGVKEIFTSKKCIDTIENLGFFFTSANSINFGRLLPQIVYYIWS
YIVLLKNGDIREGEKINFVVPTGNFGNILAGFIAKIMGIPINKLIVASNINSVVADFIRT
GLYDRRREFYKTISPSMDILVASNLERLLYLVTKDSEKVKKYMLDLKTEGYFKVEEKVLK
EIQESFWGDFSTDDQTRNSIKTIYSEYGYLVDPHSAVGFDVYSKYQKQTLDSTKTVVLQT
ANPYKFAKDVLNALFDSEYNNIDPFEAVEVLYTKTCFEVPEGIKNLISKPILHPDVIEKD
KMFDFILEKIRDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatataagtacaagaggaaataaagaagtacaggcaaaagaggcaatttacaga
ggaatagctgaggatggaggactttacacccctgtttcaattccttctcttgatttaagt
aagataaaaaacatagactcttacgaaaatcttgcaaaatatatatttgagctctacctt
actgattttacgaatgatgaaattgctgattgtattgacaagtcatacagccgtggcaag
tttgacacaaaagatgttgtgactatcaaaaagctcagctcgagtctttttgcacttgag
ttgtggcatggtccgacgtacgcttttaaagatgttgcattgcaggtgctacctcatctt
ttgctaaaatcaatgccaactttttacaaacaggcactcatacttgttgcaacatcaggc
gataccggcaaggctgcgttagaaggatttagggatgtggatagaacaaagatagttgta
ttttatccatctgagggtgtgtctgaggttcaaaaaagacagatgataacccaggagggc
agaaatacttttgttgccggaataaaaggcaattttgacgatgcccaatctggtgtgaag
gagattttcacaagcaaaaaatgcatagatacaatcgaaaatctggggtttttctttacc
tccgcaaactcaataaattttggtaggcttcttccacagattgtatactacatctggagc
tatattgtacttttgaagaatggtgatattcgcgaaggtgaaaaaataaactttgttgtt
ccgacaggaaattttggtaatatattggcaggttttattgcaaagatcatgggaattcct
ataaataagcttattgttgcttcgaacataaacagtgttgttgcagattttatcaggaca
ggcttgtacgacagaagaagagaattttacaaaacaatttcaccttcaatggacatcctt
gttgcaagtaatttggagaggttattatacttggttacaaaagattcagaaaaagtaaaa
aaatacatgttagatttgaagactgaggggtatttcaaagttgaagaaaaggttttaaaa
gagattcaagagagtttctggggcgatttttccacagatgaccagacaagaaatagcata
aagactatttacagcgaatatggttatcttgttgacccgcactctgctgttgggtttgat
gtttacagcaagtaccagaagcaaaccttggatagtacaaaaacggttgtgctacaaact
gcaaatccttacaaatttgcaaaagatgttttgaacgctttgtttgatagtgaatataat
aatattgacccgtttgaagcggttgaggttttgtacacaaagacgtgttttgaggttcca
gaagggataaaaaatcttatttcaaagccaattttacatcctgatgtgatagaaaaagac
aaaatgtttgatttcatattagagaaaataagagataattga

DBGET integrated database retrieval system