KEGG   Caldicellulosiruptor obsidiansis: COB47_0611Help
Entry
COB47_0611        CDS       T01293                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    COB47_0611
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    COB47_0611
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    COB47_0611
Enzymes [BR:cob01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     COB47_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
715926..717407
Genome map
AA seq 493 aa AA seqDB search
MRYISTRGNKEVQAKEAIYRGIAEDGGLYTPVSIPSLDLSKIKNIDSYENLAKYIFELYL
TDFTNDEIADCIDKSYSRGKFDTKDVVTIKKLSSSLFALELWHGPTYAFKDVALQVLPHL
LLKSMPTFYKQALILVATSGDTGKAALEGFRDVDRTKIVVFYPSEGVSEVQKRQMITQEG
RNTFVAGIKGNFDDAQSGVKEIFTSKKCIDTIENLGFFFTSANSINFGRLLPQIVYYIWS
YIVLLKNGDIREGEKINFVVPTGNFGNILAGFIAKIMGIPINKLIVASNINSVVADFIRT
GLYDRRREFYKTISPSMDILVASNLERLLYLVTKDSEKVKKYMLDLKTEGYFKVEEKVLK
EIQESFWGDFSTDDQTRNSIKTIYSEYGYLVDPHSAVGFDVYSKYQKQTLDSTKTVVLQT
ANPYKFAKDVLNALFDSEYNNIDPFEAVEVLYTKTCFEVPEGIKNLISKPILHPDVIEKD
KMFDFILEKIRDN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcgatatataagtacaagaggaaataaagaagtacaggcaaaagaggcaatttacaga
ggaatagctgaggatggaggactttacacccctgtttcaattccttctcttgatttaagt
aagataaaaaacatagactcttacgaaaatcttgcaaaatatatatttgagctctacctt
actgattttacgaatgatgaaattgctgattgtattgacaagtcatacagccgtggcaag
tttgacacaaaagatgttgtgactatcaaaaagctcagctcgagtctttttgcacttgag
ttgtggcatggtccgacgtacgcttttaaagatgttgcattgcaggtgctacctcatctt
ttgctaaaatcaatgccaactttttacaaacaggcactcatacttgttgcaacatcaggc
gataccggcaaggctgcgttagaaggatttagggatgtggatagaacaaagatagttgta
ttttatccatctgagggtgtgtctgaggttcaaaaaagacagatgataacccaggagggc
agaaatacttttgttgccggaataaaaggcaattttgacgatgcccaatctggtgtgaag
gagattttcacaagcaaaaaatgcatagatacaatcgaaaatctggggtttttctttacc
tccgcaaactcaataaattttggtaggcttcttccacagattgtatactacatctggagc
tatattgtacttttgaagaatggtgatattcgcgaaggtgaaaaaataaactttgttgtt
ccgacaggaaattttggtaatatattggcaggttttattgcaaagatcatgggaattcct
ataaataagcttattgttgcttcgaacataaacagtgttgttgcagattttatcaggaca
ggcttgtacgacagaagaagagaattttacaaaacaatttcaccttcaatggacatcctt
gttgcaagtaatttggagaggttattatacttggttacaaaagattcagaaaaagtaaaa
aaatacatgttagatttgaagactgaggggtatttcaaagttgaagaaaaggttttaaaa
gagattcaagagagtttctggggcgatttttccacagatgaccagacaagaaatagcata
aagactatttacagcgaatatggttatcttgttgacccgcactctgctgttgggtttgat
gtttacagcaagtaccagaagcaaaccttggatagtacaaaaacggttgtgctacaaact
gcaaatccttacaaatttgcaaaagatgttttgaacgctttgtttgatagtgaatataat
aatattgacccgtttgaagcggttgaggttttgtacacaaagacgtgttttgaggttcca
gaagggataaaaaatcttatttcaaagccaattttacatcctgatgtgatagaaaaagac
aaaatgtttgatttcatattagagaaaataagagataattga

DBGET integrated database retrieval system