KEGG   Caldicellulosiruptor obsidiansis: COB47_0643Help
Entry
COB47_0643        CDS       T01293                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cob00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    COB47_0643
Enzymes [BR:cob01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     COB47_0643
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
752232..753518
Genome map
AA seq 428 aa AA seqDB search
MKFELLHPADQIVMIMERIYGYGMTTTSGGNISIKDDNGDIWITPSGIDKGSLKSSDIIQ
VKEDGEIIGKHNPSVELPFHEMIYRARPDIKAIIHAHPPAIMAFSLARKIPNTKLIPNVH
LICGEVELVDYALPGSTELGQKIADTFKKGVSTAVLANHGIVVGAENLFKAFMAFETLDF
CAQLEIRAKLIGEPKSLRPKDIEISKAKQDIQMDEFIPKTYSSFERLSRKKMCELIHRAY
DQRLFTSTQGTFSQRLSSNSFIITPYMVDRKYIQPEDIVRIENGYKEAGKRPSRSVLLHK
YIYEKHPDVNAIIIAHPPNIMAFAVTDNEFDSKTIPETYISLRNVKKIPFGSSFMQPKMT
ADVFSKETPAVIVENDSVIVVGKDLLDAFDKLEVLEFTAKAIIDARRLGDVVLISQEEIE
EIERAFKL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgaactactacatccagccgaccagatagttatgataatggagagaatatac
ggctatggtatgacaacaacatctggcggtaacatatcaattaaagatgataatggcgat
atctggattacaccatctgggatagacaagggaagtttaaaaagtagcgatattatccag
gtaaaagaagatggagaaataatcggcaaacacaatccttctgttgaacttccatttcat
gagatgatataccgtgcaaggcctgatataaaagcaataattcatgcgcatccaccggcg
attatggcgttttcgcttgcacgcaaaattccaaatacaaaactgattccgaatgttcat
ctcatatgcggcgaagttgagcttgttgactatgctttgccgggaagcactgagcttggt
caaaagatagctgatacattcaaaaaaggggtatcaacagctgttttggcaaaccacggg
attgttgtaggtgcagaaaaccttttcaaagcgtttatggcgtttgaaacgcttgatttt
tgtgctcagcttgagataagagcaaagcttattggtgagcctaaatcacttagacccaaa
gacattgagatttcaaaagcaaaacaggatattcaaatggatgagttcattccaaagaca
tattcaagtttcgaaagactctcaagaaagaagatgtgtgaacttatccacagggcatat
gaccagagactttttacaagcacgcaaggaacattttcccaaagacttagtagcaattct
tttattatcacaccatacatggtggatagaaaatacatccagccagaagatattgttagg
atagaaaatggatacaaggaggctggaaaaaggccgagcaggtcagtgcttttgcacaag
tatatttatgaaaagcatccagatgtcaatgctataatcattgctcatccgccgaatata
atggcttttgcagtgacagataatgagtttgattcaaaaacaatacccgaaacttatatt
tctctcagaaatgttaaaaagattccgtttggttcatcatttatgcagccaaaaatgact
gcagatgtgttttctaaagagactccagccgtgattgtagaaaatgacagtgtaattgtt
gttggtaaagaccttttagatgcatttgacaagcttgaggtacttgagttcactgcaaag
gccatcatagatgcaagaagattgggtgatgttgtgctaataagccaagaggaaatcgaa
gaaatagaaagagcatttaaactgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system