KEGG   Caldicellulosiruptor obsidiansis: COB47_0701Help
Entry
COB47_0701        CDS       T01293                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
cob  Caldicellulosiruptor obsidiansis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:cob00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:cob00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
817328..818830
Genome map
AA seq 500 aa AA seqDB search
MLTKKMRNRKGEDFLKLKDLIENIDVLETNVGDFDKDITDIAYNSKNAKEGSAFVCIKGF
KTDGHEYIDEAIQNGARLVVVDEFFDTSKIEGKIDYIKTSNTRKALAVMSANFFAHPSKD
FLLIGVTGTNGKTSTTFMIKSILEANGQKVGLIGTIKNMIGSKEIEAQHTTPESYDLQKL
FWQMKSEGVDSVVMEVSSHSLELFRVYACDFDVGVFTNLTQDHLDFHGTMENYFSAKLKL
FGMSKKRVVNADDSWGKRIIEMYPDCITYAKDSDANVCAQNIKLFVNKNQFDLYYNNKKE
NILLNIPGLFSIYNSLAAAACCILLGIELDTIKKGLEELKAVPGRFEIVESNQKFTVVID
YAHTPDGLLNLMKTVNEVADGRKVLLFGCGGDRDRTKRPIMGEIAGKMADFVIVTSDNPR
TEDPLKIIADILEGIKKTNVEYVVIPDRYEAIKYAIKNARENDFIVLAGKGHETYQILKD
RTIPFDEREVVKNILKELRE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttgctgacaaagaaaatgcggaatagaaagggtgaagacttcttgaaattaaaagattta
attgagaacattgatgttttggaaactaatgttggagattttgataaagatataactgat
attgcgtacaattcaaagaatgcaaaagaaggttctgcttttgtatgtataaaaggcttc
aagacagatggacatgaatatatcgatgaggcaatccaaaatggtgcacgtttggtagtt
gtagatgagttttttgacacgtctaaaattgaagggaagattgattatatcaagacttca
aataccagaaaggcacttgctgtaatgtctgcaaacttttttgctcatccatcaaaagat
tttttgcttattggtgtgacaggtacaaacggcaaaacttcaacaacatttatgataaaa
tctatacttgaagctaatggacagaaagttgggttgattggtacaatcaaaaatatgata
ggtagtaaagaaattgaggctcagcatacaactcctgagtcttatgacctgcaaaaactc
ttttggcagatgaaaagtgagggtgttgacagtgttgtaatggaggtttcttcgcactct
cttgagctttttagagtatatgcctgtgattttgatgttggagtttttacaaacctgact
caagatcatttagattttcatggaacaatggaaaattatttttcagcaaaattaaaactt
ttcggtatgagcaagaaaagagtagtaaatgctgacgacagttggggaaaaaggattatt
gagatgtatcctgactgtataacatatgccaaggacagtgatgctaacgtttgcgcacag
aatattaaactttttgttaacaaaaaccagtttgatctgtactataataacaaaaaagag
aatatattacttaatatcccaggacttttttcaatttacaatagccttgctgctgcggcg
tgttgcattctgcttggcattgaacttgatacaataaaaaaaggacttgaggaattaaaa
gctgtaccgggcagatttgagatagttgagtcaaaccaaaagtttactgtggtgattgac
tatgcacacacccctgacggtcttttaaatcttatgaaaacagtaaatgaagttgcagat
ggtagaaaggtactgctttttggatgcgggggagacagagacaggacaaaaagaccaatt
atgggcgagattgctggcaagatggcagattttgtgattgttacatctgacaatccgcga
acagaagatccactcaagataattgctgatatcttggaagggataaaaaagacaaatgtt
gagtatgtggtcatacccgacaggtatgaggctattaaatatgccataaagaatgcaaga
gaaaatgattttattgtccttgccggtaagggacatgagacttaccagattttaaaagat
agaacaataccgtttgatgagagagaggttgtgaagaatatcttaaaggagctaagagaa
tga

DBGET integrated database retrieval system